Dataset for protein Bim of organism Equus caballus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfpaaaagaarargaargalgcpaerggggraasgrlcavlaplsaspglclprclsgdnqgapgrrkaragrrgarart
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             *****************************************                          
-------------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQ--------------------------
rrsegkgrikkdq                                         gnpggegdrcpqgsplgplappaspg
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                            ********************
------------------------------drspapmscdkstqtpsppcqafnhylsamASMRQSQAVPADMRPEVWIA
pfatrspffifvrrssllsrsssgyfsfdt------------------------------                    
                                                                                

       250       260       270       280         
....:....|....:....|....:....|....:....|....:....
*****************:                               
QELRRIGDEFNASYPRRvvqnhhqaa-----------------------
                 lel------eahpqmiilrllryiirlvrrlq
                  a clafyt                       
© 1998-2020Legal notice