Dataset for protein Bim of organism Equus caballus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      MFPAAAAGAARARGAARGALGCPAERGGGGRAASGRLCAVLAPLSASPGL
A0A3Q2GRS5_BCL2L11      MFPAAAAGAARARGAARGALGCPAERGGGGRAASGRLCAVLAPLSASPGL
                                                                          

A0A3Q2GRS5_BCL2L11      -------------------------------------------MAKQPSD
A0A3Q2GRS5_BCL2L11      -------------------------------------------MAKQPSD
A0A3Q2GRS5_BCL2L11      -------------------------------------------MAKQPSD
A0A3Q2GRS5_BCL2L11      CLPRCLSGDNQGAPGRRKARAGRRGARARTRRSEGKGRIKKDQMAKQPSD
A0A3Q2GRS5_BCL2L11      CLPRCLSGDNQGAPGRRKARAGRRGARARTRRSEGKGRIKKDQMAKQPSD
                                                                   *******

A0A3Q2GRS5_BCL2L11      VSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQ----------------
A0A3Q2GRS5_BCL2L11      VSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQ----------------
A0A3Q2GRS5_BCL2L11      VSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQGNPGGEGDRCPQGSPL
A0A3Q2GRS5_BCL2L11      VSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQ----------------
A0A3Q2GRS5_BCL2L11      VSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQGNPGGEGDRCPQGSPL
                        **********************************                

A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      GPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCD
A0A3Q2GRS5_BCL2L11      ----------------------------------------DRSPAPMSCD
A0A3Q2GRS5_BCL2L11      GPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCD
                                                                          

A0A3Q2GRS5_BCL2L11      --------------------DRSPAPMSCDKSTQTPSPPCQAF----NHY
A0A3Q2GRS5_BCL2L11      --------------------ASMRQSQAVPADMRPEVWIAQELRRIGDEF
A0A3Q2GRS5_BCL2L11      KSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEVWIAQELRRIGDEF
A0A3Q2GRS5_BCL2L11      KSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEVWIAQELRRIGDEF
A0A3Q2GRS5_BCL2L11      KSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEVWIAQELRRIGDEF
                                                 . :   . ..    .* :    : :

A0A3Q2GRS5_BCL2L11      LSAMVRAIEEVVV--------------------------
A0A3Q2GRS5_BCL2L11      NASYPRRLAQCLAFYT-----------------------
A0A3Q2GRS5_BCL2L11      NASYPRRLEQ-----------------------------
A0A3Q2GRS5_BCL2L11      NASYPRRVVLNHHQAAEAHPQMIILRLLRYIIRLVRRLQ
A0A3Q2GRS5_BCL2L11      NASYPRRVVLNHHQAAEAHPQMIILRLLRYIIRLVRRLQ
                         ::  * :                               

© 1998-2020Legal notice