Dataset for protein Bim of organism Equus caballus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A3Q2GRS5_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Equus caballus GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQGNPGGEGDRCPQGSPLGPLAPPASPGPFATRSPFFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEVWIAQELRRIGDEFNAS
YPRRLEQ
>gnl|bcl2dbpro|A0A3Q2GRS5_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Equus caballus GN=BCL2L11 (length=233 residues).
MFPAAAAGAARARGAARGALGCPAERGGGGRAASGRLCAVLAPLSASPGLCLPRCLSGDNQGAPGRRKARAGRRGARART
RRSEGKGRIKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQDRSPAPMSCDKSTQTPSPPCQAFNHY
LSAMASMRQSQAVPADMRPEVWIAQELRRIGDEFNASYPRRVVLNHHQAAEAHPQMIILRLLRYIIRLVRRLQ
>gnl|bcl2dbpro|A0A3Q2GRS5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Equus caballus GN=BCL2L11 (length=80 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVRAIEEVVV
>gnl|bcl2dbpro|A0A3Q2GRS5_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Equus caballus GN=BCL2L11 (length=289 residues).
MFPAAAAGAARARGAARGALGCPAERGGGGRAASGRLCAVLAPLSASPGLCLPRCLSGDNQGAPGRRKARAGRRGARART
RRSEGKGRIKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQGNPGGEGDRCPQGSPLGPLAPPASPG
PFATRSPFFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEVWIA
QELRRIGDEFNASYPRRVVLNHHQAAEAHPQMIILRLLRYIIRLVRRLQ
>gnl|bcl2dbpro|A0A3Q2GRS5_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Equus caballus GN=BCL2L11 (length=87 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQASMRQSQAVPADMRPEVWIAQELRRIGDEFNASYPRRLA
QCLAFYT
© 1998-2020Legal notice