Dataset for protein classical BH3-containing proteins of organism Electrophorus electricus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
        lfkendtredlkaqir-kt-e-qpetdqnsrcvnpfrrea                  l-sktprdqsdapr
         ddae  fd ia  ckphsr qe                                    mkde c kra i 
                       a  h                                           a       g 

        90       100       110       120       130       140       150       160
dv-q-ng-rwaetseged       hhm  nfatqwiewq nhfmnetytvshwpptrsssrvs-rsppnq-wvepprrr
atad gemke   i                     lgaep l  lg  glll qedgepqdgrr mlgggicega f g 
     dd                                  d  ee     e ad aaen ad   eae a a       

       170       180       190       200       210       220       230       240
                                               . :*. :.* :                      
-sp-sqviihalqriseaqgngqnyelwtgppnealsvrdmraakkvare qmis didtiyfr-evr-vssy-l-s-qh
sqsapaalw                                 pvssi ck  k   q -rwldk  mmaar pqklrtmq
 lh                                       k aec         l   l     ik    nfghmlkp
                                                                   e    c e c   
                                                                        a a a   

       250       260       270      
rsprphqvf sr legplpsspv-rylkvvrgcd  
aqngnalp  cn iaelelrflicqrddlp e    
   e  kl   g a agdkq ge egaa        
      a         a    f  a           
© 1998-2023Legal notice