Dataset for protein classical BH3-containing proteins of organism Electrophorus electricus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W4H0G9_PMAIP1-      --------------------------------------------------
A0A4W4DXF5_BAD-01       MHNQYLLRLRKANFTREDYKKVIKAKTLREEGETPSNTSCWNPFRVTA--
A0A4W4DZH9_BMF-01       --------MDDEEDDVFRIAAQYWPHSLRE--------------------
A0A4W4HE29_BAD-01       --------MFNSSFDFDRLRKVCAARHREQQPPADQTSRSVSVSYREFTS
A0A4W4H3Y1_BCL2L11      ------------------------IRQNRANGPA----------------
A0A4W4H3Y1_BCL2L11      -----------------------RIRQNRANGPA----------------
                                                                          

A0A4W4H0G9_PMAIP1-      ------------------------KQAGTSPV------------------
A0A4W4DXF5_BAD-01       ---------------FTMEKAPCGQRDDISALDDQDESRWSETIESDDSP
A0A4W4DZH9_BMF-01       -----------------IKQEERGTQTAGRPLARPNGM------------
A0A4W4HE29_BAD-01       AAGQLSEVVFTMAQMFTISDTESDTSEGPGDTDQQGDSKEAEPSQSEQ--
A0A4W4H3Y1_BCL2L11      ---------------FLKEQGESGENTGVGTASRPEQFDCSHPNQGDQ--
A0A4W4H3Y1_BCL2L11      ---------------FLKEQGESGENTGVGTASRPEQFDCSHPNQGDQ--
                                                                          

A0A4W4H0G9_PMAIP1-      -----------TPCQLISWLSDLFLEQT----------------------
A0A4W4DXF5_BAD-01       RISNHHIMPNNTATEVGGRVRLYSESQAYTVSHWEDTESQDGVSAEEGGG
A0A4W4DZH9_BMF-01       -----------LPCGVSEEPRRLFYGSAGLLLLAPPARPNSADDAMLPEN
A0A4W4HE29_BAD-01       ----HLHVPNTLRGEWTARQRNHSMNEA---ELQDSGAESFRRRSRSAPP
A0A4W4H3Y1_BCL2L11      -----------FRGGITSSLSGYHSRSPLFRTLSRSSSGYFSFDSEPSSP
A0A4W4H3Y1_BCL2L11      -----------FRGGITSSLSGYHSRSPLFRTLSRSSSGYFSFDSEPSSP
                                                  ..                      

A0A4W4H0G9_PMAIP1-      --------------------------------------------------
A0A4W4DXF5_BAD-01       ACEGAPFRGRSQSAPAALW-------------------------------
A0A4W4DZH9_BMF-01       QLAVEPPRRRPLHS------------------------------------
A0A4W4HE29_BAD-01       ILW-----------------------------------------------
A0A4W4H3Y1_BCL2L11      LMTHSTSTQTPSPSSQVIIHALQ---------------------------
A0A4W4H3Y1_BCL2L11      LMTHSTSTQTPSPSSQVIIHALQRISEAQGNGQNYELWTGPPNEALSVRD
                                                                          

A0A4W4H0G9_PMAIP1-      --VVSECACQLRRMGDLIN--------------------------WKYLL
A0A4W4DXF5_BAD-01       --KAKKYGRQLRRMSDEFDTWLDKGEIRRVSSPGKLSQKQTNQGWFSFLW
A0A4W4DZH9_BMF-01       --VEASIGQKLQMIGDQF--------------YQEHMLQHRNQRNHQPFW
A0A4W4HE29_BAD-01       --AAKKYGRQLRKMSDEFDTLLDKG-MKRARSAGAARQMHTSPSWFAFLW
A0A4W4H3Y1_BCL2L11      --PELYVAQELRRIGDDFNRIYFRG-VMA---CFLACT-------FVVLW
A0A4W4H3Y1_BCL2L11      MRAELYVAQELRRIGDDFNRIYFRG-VER---NGGAAQQPAQNEPALLQW
                               . :*. :.* :                                

A0A4W4H0G9_PMAIP1-      LHLIADARTRLGICSGNDVVALCM--
A0A4W4DXF5_BAD-01       CSKEEEGRK-----------------
A0A4W4DZH9_BMF-01       LRLASALYVLLFEREPAARWRGVDQR
A0A4W4HE29_BAD-01       SHKESDTETSSSVTAPDTRPAE----
A0A4W4H3Y1_BCL2L11      INLWINPDPLFPLTQYLKL-------
A0A4W4H3Y1_BCL2L11      IGLLIGRLLQLLLRRR----------
                                                  

© 1998-2020Legal notice