Dataset for protein classical BH3-containing proteins of organism Electrophorus electricus

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A4W4DXF5_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Electrophorus electricus GN=BAD (length=209 residues).
MHNQYLLRLRKANFTREDYKKVIKAKTLREEGETPSNTSCWNPFRVTAFTMEKAPCGQRDDISALDDQDESRWSETIESD
DSPRISNHHIMPNNTATEVGGRVRLYSESQAYTVSHWEDTESQDGVSAEEGGGACEGAPFRGRSQSAPAALWKAKKYGRQ
LRRMSDEFDTWLDKGEIRRVSSPGKLSQKQTNQGWFSFLWCSKEEEGRK
>gnl|bcl2dbpro|A0A4W4DZH9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Electrophorus electricus GN=BMF (length=156 residues).
MDDEEDDVFRIAAQYWPHSLREIKQEERGTQTAGRPLARPNGMLPCGVSEEPRRLFYGSAGLLLLAPPARPNSADDAMLP
ENQLAVEPPRRRPLHSVEASIGQKLQMIGDQFYQEHMLQHRNQRNHQPFWLRLASALYVLLFEREPAARWRGVDQR
>gnl|bcl2dbpro|A0A4W4H0G9_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Electrophorus electricus GN=PMAIP1 (length=71 residues).
KQAGTSPVTPCQLISWLSDLFLEQTVVSECACQLRRMGDLINWKYLLLHLIADARTRLGICSGNDVVALCM
>gnl|bcl2dbpro|A0A4W4H3Y1_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Electrophorus electricus GN=BCL2L11 (length=161 residues).
IRQNRANGPAFLKEQGESGENTGVGTASRPEQFDCSHPNQGDQFRGGITSSLSGYHSRSPLFRTLSRSSSGYFSFDSEPS
SPLMTHSTSTQTPSPSSQVIIHALQPELYVAQELRRIGDDFNRIYFRGVMACFLACTFVVLWINLWINPDPLFPLTQYLK
L
>gnl|bcl2dbpro|A0A4W4H3Y1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Electrophorus electricus GN=BCL2L11 (length=195 residues).
RIRQNRANGPAFLKEQGESGENTGVGTASRPEQFDCSHPNQGDQFRGGITSSLSGYHSRSPLFRTLSRSSSGYFSFDSEP
SSPLMTHSTSTQTPSPSSQVIIHALQRISEAQGNGQNYELWTGPPNEALSVRDMRAELYVAQELRRIGDDFNRIYFRGVE
RNGGAAQQPAQNEPALLQWIGLLIGRLLQLLLRRR
>gnl|bcl2dbpro|A0A4W4HE29_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Electrophorus electricus GN=BAD (length=205 residues).
MFNSSFDFDRLRKVCAARHREQQPPADQTSRSVSVSYREFTSAAGQLSEVVFTMAQMFTISDTESDTSEGPGDTDQQGDS
KEAEPSQSEQHLHVPNTLRGEWTARQRNHSMNEAELQDSGAESFRRRSRSAPPILWAAKKYGRQLRKMSDEFDTLLDKGM
KRARSAGAARQMHTSPSWFAFLWSHKESDTETSSSVTAPDTRPAE
© 1998-2020Legal notice