Dataset for protein Bim of organism Electrophorus electricus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160
**************************                             .*********************** 
                          riseaqgngqnyelwtgppnealsvrdmra                       e

       170       180       190        
    *.         :: **.* *.    : * .    
acfg aqqpaqnepalll  g l gpdllfl rqrlkl
© 1998-2022Legal notice