Dataset for protein Bim of organism Electrophorus electricus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A4W4H3Y1_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Electrophorus electricus GN=BCL2L11 (length=161 residues).
IRQNRANGPAFLKEQGESGENTGVGTASRPEQFDCSHPNQGDQFRGGITSSLSGYHSRSPLFRTLSRSSSGYFSFDSEPS
SPLMTHSTSTQTPSPSSQVIIHALQPELYVAQELRRIGDDFNRIYFRGVMACFLACTFVVLWINLWINPDPLFPLTQYLK
L
>gnl|bcl2dbpro|A0A4W4H3Y1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Electrophorus electricus GN=BCL2L11 (length=195 residues).
RIRQNRANGPAFLKEQGESGENTGVGTASRPEQFDCSHPNQGDQFRGGITSSLSGYHSRSPLFRTLSRSSSGYFSFDSEP
SSPLMTHSTSTQTPSPSSQVIIHALQRISEAQGNGQNYELWTGPPNEALSVRDMRAELYVAQELRRIGDDFNRIYFRGVE
RNGGAAQQPAQNEPALLQWIGLLIGRLLQLLLRRR
© 1998-2020Legal notice