Dataset for protein Bim of organism Electrophorus electricus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W4H3Y1_BCL2L11      -IRQNRANGPAFLKEQGESGENTGVGTASRPEQFDCSHPNQGDQFRGGIT
A0A4W4H3Y1_BCL2L11      RIRQNRANGPAFLKEQGESGENTGVGTASRPEQFDCSHPNQGDQFRGGIT
                         *************************************************

A0A4W4H3Y1_BCL2L11      SSLSGYHSRSPLFRTLSRSSSGYFSFDSEPSSPLMTHSTSTQTPSPSSQV
A0A4W4H3Y1_BCL2L11      SSLSGYHSRSPLFRTLSRSSSGYFSFDSEPSSPLMTHSTSTQTPSPSSQV
                        **************************************************

A0A4W4H3Y1_BCL2L11      IIHALQ-----------------------------PELYVAQELRRIGDD
A0A4W4H3Y1_BCL2L11      IIHALQRISEAQGNGQNYELWTGPPNEALSVRDMRAELYVAQELRRIGDD
                        ******                             .**************

A0A4W4H3Y1_BCL2L11      FNRIYFRGVMACFLACT-------FVVLWINLWINPDPLFPLTQYLKL
A0A4W4H3Y1_BCL2L11      FNRIYFRGVERNGGAAQQPAQNEPALLQWIGLLIGRLLQLLLRRR---
                        *********     *.         :: **.* *.    : * .    

© 1998-2020Legal notice