Dataset for protein classical BH3-containing proteins of organism Dromaius novaehollandiae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                        :  :                    
                                 mpsriktlkkyqrllesrh  gs pa n                   

        90       100       110       120       130       140       150       160
                                                         .    * :*. *.*:::      
-------------------------------------------------vsdpahqkpviwc vq rr g kwnlsykpr
                                                  acf  ge  ae  qe      e  arqcil

       170       180       190       200       210         
  : .                                                      
nlia ghfpfspsanvllpgsvsggqrstlyvsys-s-swrksvlqlslrldngieaar
     f  lenfg ctk  fpsa  ff gkttc m p csdephhke afi        
© 1998-2023Legal notice