Dataset for protein classical BH3-containing proteins of organism Dromaius novaehollandiae

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A8C4J3Z9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Dromaius novaehollandiae GN=BMF (length=193 residues).
MDHPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGSRHPEQQDKATQT
LSQSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPSVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHVQR
HQQNRNQVWWQLFLFLHNLALNVEANRNHTGQR
>gnl|bcl2dbpro|A0A8C4J3Z9_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Dromaius novaehollandiae GN=BMF (length=209 residues).
MDHPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGSRHPEQQDKATQT
LSQSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPSVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHVQR
HQQNRNQVWWQLFLFLHNLALNVEANRNHTGQRVLSSGAVIDQQIKAAS
>gnl|bcl2dbpro|A0A8C4J3Z9_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Dromaius novaehollandiae GN=BMF (length=201 residues).
MDHPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGSRHPEQQDKATQT
LSQSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPSVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHVQR
HQQNRNQVWWQLFLFLHNLALNVEANRNHTGQSHRKEGLFL
>gnl|bcl2dbpro|A0A8C4J3Z9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Dromaius novaehollandiae GN=BMF (length=198 residues).
MDHPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGSRHPEQQDKATQT
LSQSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPSVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHVQR
GHCLFNPGNCVKVWGSSAGGQRNGLYVCESPSRSSDER
>gnl|bcl2dbpro|A0A8C4J5J5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Dromaius novaehollandiae GN=BCL2L11 (length=99 residues).
MSVWGVNAIQADPAHGKPEIWIAQELRRIGDEFNASYCPRRVIFRFFFSVSFSANTLLPFPVSLFFFSTKTTSYMPPRCW
RKPYHQLSMRVLNGLEQVR
>gnl|bcl2dbpro|A0A8C4K602_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Dromaius novaehollandiae GN=PMAIP1 (length=72 residues).
MPSRIKTLKKYQRLLESRHGRGTLPALRACVSCFAEQEAVAECAVQLRRIGDKWNLRQKILNLLAKLFCPET
© 1998-2022Legal notice