Dataset for protein classical BH3-containing proteins of organism Dromaius novaehollandiae

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4J3Z9_BMF-02       MDHPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8C4J3Z9_BMF-04       MDHPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8C4J3Z9_BMF-01       MDHPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8C4J3Z9_BMF-03       MDHPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8C4J5J5_BCL2L11      --------------------------------------------------
A0A8C4K602_PMAIP1-      ---------------------------------MPSRIKTLKKYQRLLES
                                                                          

A0A8C4J3Z9_BMF-02       LLGRFQLFPLTHCCGPGSRHPEQQDKATQTLSQSSSSQDVMLPCGVTEEP
A0A8C4J3Z9_BMF-04       LLGRFQLFPLTHCCGPGSRHPEQQDKATQTLSQSSSSQDVMLPCGVTEEP
A0A8C4J3Z9_BMF-01       LLGRFQLFPLTHCCGPGSRHPEQQDKATQTLSQSSSSQDVMLPCGVTEEP
A0A8C4J3Z9_BMF-03       LLGRFQLFPLTHCCGPGSRHPEQQDKATQTLSQSSSSQDVMLPCGVTEEP
A0A8C4J5J5_BCL2L11      ----MSVWGVNAI-------------------------------------
A0A8C4K602_PMAIP1-      RHGRGTLPALRAC-------------------------------------
                              :  :                                        

A0A8C4J3Z9_BMF-02       RRLFYGNAGYRLHVPSVGFALDPHLQEEPQEGQREARAEVQIARKLQCIA
A0A8C4J3Z9_BMF-04       RRLFYGNAGYRLHVPSVGFALDPHLQEEPQEGQREARAEVQIARKLQCIA
A0A8C4J3Z9_BMF-01       RRLFYGNAGYRLHVPSVGFALDPHLQEEPQEGQREARAEVQIARKLQCIA
A0A8C4J3Z9_BMF-03       RRLFYGNAGYRLHVPSVGFALDPHLQEEPQEGQREARAEVQIARKLQCIA
A0A8C4J5J5_BCL2L11      -----------------------------QADPAHGKPEIWIAQELRRIG
A0A8C4K602_PMAIP1-      -----------------------------VSCFAEQEAVAECAVQLRRIG
                                                             .    * :*. *.

A0A8C4J3Z9_BMF-02       DQFHRLH-----VQRGHCLFNPGNCVKVWGSSAGGQRNGLYVCESPSRSS
A0A8C4J3Z9_BMF-04       DQFHRLH-----VQR-----HQQNRNQVWWQLFLFLHNLALNVEANRNHT
A0A8C4J3Z9_BMF-01       DQFHRLH-----VQR-----HQQNRNQVWWQLFLFLHNLALNVEANRNHT
A0A8C4J3Z9_BMF-03       DQFHRLH-----VQR-----HQQNRNQVWWQLFLFLHNLALNVEANRNHT
A0A8C4J5J5_BCL2L11      DEFNASYCPRRVIFRFFFSVSFSANTLLPFPVSLFFFSTKTTSYMPPRCW
A0A8C4K602_PMAIP1-      DKWNLRQKILNLLAKLFCPET-----------------------------
                        *:::        : .                                   

A0A8C4J3Z9_BMF-02       DER----------------
A0A8C4J3Z9_BMF-04       GQRVLSSGAVIDQQIKAAS
A0A8C4J3Z9_BMF-01       GQR----------------
A0A8C4J3Z9_BMF-03       GQSHRKEGLFL--------
A0A8C4J5J5_BCL2L11      RKPYHQLSMRVLNGLEQVR
A0A8C4K602_PMAIP1-      -------------------
                                           

© 1998-2022Legal notice