Dataset for protein classical BH3-containing proteins of organism Dicentrarchus labrax

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           ..: .  .               . :                                           
----------mddeeddvfepdphnwstafreikceqrgtqtpgpala--------------------------------
matnftissmsksqpsgevherepcqrststavtatdgsgldl-----agacaqtnrsdnagersvgrrsssgggepdsp
         drek k ecl  g n p dgae qr p  h g  p  g                                 
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                            *     .        .. . *:   .   .      
-------------------------------pyngmlpcgvaeePrplfyg--------nagfrLhfpahfelvgdqear
swctkppidslgvfqkrtifhlprrassgyf------------- elvtadratqtpsptsrvm nslsrmstasrggpl
                               s d dslpsspls   rm           gqi   aeq aae hgd eg
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.    .              ... .    .    *.:*. :.*::     .      *      ..              
rqesegehng------meqrprqqpvarsveaciGqkLrrigDqfhslllqlyhrnqRnq----gpl--------wwrlg
qhrqhdhfptptdgapsstlsksaapdmwaak-y rq qlms eynrehdrgwmkkv salihlnsarqmhqsrtml---
 aqg   ags      frg   n  g lq   k   e      d    k eaggr r        phi heps  fcm
                                                                                

       250       260       270       280       290       300      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
      :       *  .   .                                            
aallsllfdrgfiaGrggagrr--------------------------------------------
----lyigsiqytq stnsqenstvrtvdqlvplisshtavpaaatssqlsvslhadwlmrlprgl
gl      rhiele endhhdhhqspde                                      
                      edh                                         
© 1998-2023Legal notice