Dataset for protein classical BH3-containing proteins of organism Dicentrarchus labrax

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8P4G4W6_BCL2L11      ---------MRKKQKDGCLHPRPPNPSDGSTAVTATQGSGGDPPPAGAAG
A0A8P4GSG1_BAD-01       MATNFTISSDSESEPSEEVEEGENNQSSTAEEQRAPQRHTLTL-------
A0A8C4DD37_BMF-02       ----------MDDEEDDVFEPDPHCWRTAFREIKCEDRGTQTPGPALA--
A0A8C4DD37_BMF-01       ----------MDDEEDDVFEPDPHCWRTAFREIKCEDRGTQTPGPALA--
                                   ..: .  .               . :             

A0A8P4G4W6_BCL2L11      ACAQTNRSDNAGERSVGRRSSSGGGEPDSPSWCTKPPIDSLGVFQKRTIF
A0A8P4GSG1_BAD-01       --------------------------------------------------
A0A8C4DD37_BMF-02       --------------------------------------------------
A0A8C4DD37_BMF-01       --------------------------------------------------
                                                                          

A0A8P4G4W6_BCL2L11      HLPRRASSGYFSYDGDSLPSSPLSPRPVTADRATQTPSPNSQVMLHALQR
A0A8P4GSG1_BAD-01       ------------------------PELRMAG--------TGRIRLNSESH
A0A8C4DD37_BMF-02       -----------PYNGMLPCGVAEEPRPLFYG--------NAGFRLHFPAH
A0A8C4DD37_BMF-01       -----------PYNGMLPCGVAEEPRPLFYG--------NAGFRLHFPAH
                                                *     .        .. . *:   .

A0A8P4G4W6_BCL2L11      MAEAHGGGPGRHQQHGHFPS-----PSSTRPRNAAGDMQAEA-IGQELRR
A0A8P4GSG1_BAD-01       ASTVSRDEELQARGEDEAGTPTDGAPFRGRSKSAPPALWAAKKYGRQLRR
A0A8C4DD37_BMF-02       FELVGDQEARRQESEGEHNG------MEQLPRQQPVARSVEACIGQKLQL
A0A8C4DD37_BMF-01       FELVGDQEARRQESEGEHNG------MEQLPRQQPVARSVEACIGQKLQL
                           .      .    .              ... .    .    *.:*. 

A0A8P4G4W6_BCL2L11      IGDDYNSLLLRGWAGGRRRALIHLNPLPHIHQEPTMLFCMGLLLLLIGRI
A0A8P4GSG1_BAD-01       MSDEFDSLLDKGEMKKVRSA----GSARQMHHSRSWW-------SYLFSH
A0A8C4DD37_BMF-02       IGDQFHREHLQLYHRNQRNQ----GPL--------WWRLGAALLSLLFDR
A0A8C4DD37_BMF-01       IGDQFHREHLQLYHRNQRNQ----GPL--------WWRLGAALLSLLFDR
                        :.*::     .      *      ..                    :   

A0A8P4G4W6_BCL2L11      IYLQGSTDSQDHSQV-----------------------------------
A0A8P4GSG1_BAD-01       QETEGENNHHENHTHRTE--------------------------------
A0A8C4DD37_BMF-02       GFIAGRGGAGRREDSPDVDQLVPLISSHTAVPAAATSSQLSVSLHADWLM
A0A8C4DD37_BMF-01       GFIAGRGGAGRR--------------------------------------
                            *  .   .                                      

A0A8P4G4W6_BCL2L11      ------
A0A8P4GSG1_BAD-01       ------
A0A8C4DD37_BMF-02       RLPRGL
A0A8C4DD37_BMF-01       ------
                              

© 1998-2023Legal notice