Dataset for protein classical BH3-containing proteins of organism Dicentrarchus labrax

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C4DD37_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Dicentrarchus labrax GN=BMF (length=207 residues).
MDDEEDDVFEPDPHCWRTAFREIKCEDRGTQTPGPALAPYNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDQEARR
QESEGEHNGMEQLPRQQPVARSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLGAALLSLLFDRGFIAGRGGA
GRREDSPDVDQLVPLISSHTAVPAAATSSQLSVSLHADWLMRLPRGL
>gnl|bcl2dbpro|A0A8C4DD37_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Dicentrarchus labrax GN=BMF (length=163 residues).
MDDEEDDVFEPDPHCWRTAFREIKCEDRGTQTPGPALAPYNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDQEARR
QESEGEHNGMEQLPRQQPVARSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLGAALLSLLFDRGFIAGRGGA
GRR
>gnl|bcl2dbpro|A0A8P4G4W6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Dicentrarchus labrax GN=BCL2L11 (length=250 residues).
MRKKQKDGCLHPRPPNPSDGSTAVTATQGSGGDPPPAGAAGACAQTNRSDNAGERSVGRRSSSGGGEPDSPSWCTKPPID
SLGVFQKRTIFHLPRRASSGYFSYDGDSLPSSPLSPRPVTADRATQTPSPNSQVMLHALQRMAEAHGGGPGRHQQHGHFP
SPSSTRPRNAAGDMQAEAIGQELRRIGDDYNSLLLRGWAGGRRRALIHLNPLPHIHQEPTMLFCMGLLLLLIGRIIYLQG
STDSQDHSQV
>gnl|bcl2dbpro|A0A8P4GSG1_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Dicentrarchus labrax GN=BAD (length=168 residues).
MATNFTISSDSESEPSEEVEEGENNQSSTAEEQRAPQRHTLTLPELRMAGTGRIRLNSESHASTVSRDEELQARGEDEAG
TPTDGAPFRGRSKSAPPALWAAKKYGRQLRRMSDEFDSLLDKGEMKKVRSAGSARQMHHSRSWWSYLFSHQETEGENNHH
ENHTHRTE
© 1998-2023Legal notice