Dataset for protein Bmf of organism Denticeps clupeoides

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               *****************************************************************
---------------MEDEDEDVFSGHPHLWHTHFREIKYKDRGTQTPGPALSLGNGMLPFGLAEEPRRLFHGNAAFRLH
megvfmrqpvyvdpl                                                                 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
FPAHFERVGEAMPEDQQGQADRHHQWPSVEAQIGQKLQMIGDQFHQEHVQQHHRNQRWRRQPFLWRLAFALYTLIFERDA
                                                                                

       170       180       190       200       210       220      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
***********                                                       
VGVQGRGLEQR-------------------------------------------------------
           aggvrgrpvvstvsypgftcrttflakttaagpmsttdrrcgfhhisagstnkgl
© 1998-2022Legal notice