Dataset for protein Bmf of organism Denticeps clupeoides

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4C2E0_BMF-01      ---------------MEDEDEDVFSGHPHLWHTHFREIKYKDRGTQTPGP
A0A8C4C2E0_BMF-02      MEGVFMRQPVYVDPLMEDEDEDVFSGHPHLWHTHFREIKYKDRGTQTPGP
                                      ***********************************

A0A8C4C2E0_BMF-01      ALSLGNGMLPFGLAEEPRRLFHGNAAFRLHFPAHFERVGEAMPEDQQGQA
A0A8C4C2E0_BMF-02      ALSLGNGMLPFGLAEEPRRLFHGNAAFRLHFPAHFERVGEAMPEDQQGQA
                       **************************************************

A0A8C4C2E0_BMF-01      DRHHQWPSVEAQIGQKLQMIGDQFHQEHVQQHHRNQRWRRQPFLWRLAFA
A0A8C4C2E0_BMF-02      DRHHQWPSVEAQIGQKLQMIGDQFHQEHVQQHHRNQRWRRQPFLWRLAFA
                       **************************************************

A0A8C4C2E0_BMF-01      LYTLIFERDAVGVQGRGLEQRAGGVRGRPVVSTVSYPGFTCRTTFLAKTT
A0A8C4C2E0_BMF-02      LYTLIFERDAVGVQGRGLEQR-----------------------------
                       *********************                             

A0A8C4C2E0_BMF-01      AAGPMSTTDRRCGFHHISAGSTNKGL
A0A8C4C2E0_BMF-02      --------------------------
                                                 

© 1998-2022Legal notice