Dataset for protein Bmf of organism Denticeps clupeoides

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C4C2E0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Denticeps clupeoides GN=BMF (length=211 residues).
MEDEDEDVFSGHPHLWHTHFREIKYKDRGTQTPGPALSLGNGMLPFGLAEEPRRLFHGNAAFRLHFPAHFERVGEAMPED
QQGQADRHHQWPSVEAQIGQKLQMIGDQFHQEHVQQHHRNQRWRRQPFLWRLAFALYTLIFERDAVGVQGRGLEQRAGGV
RGRPVVSTVSYPGFTCRTTFLAKTTAAGPMSTTDRRCGFHHISAGSTNKGL
>gnl|bcl2dbpro|A0A8C4C2E0_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Denticeps clupeoides GN=BMF (length=171 residues).
MEGVFMRQPVYVDPLMEDEDEDVFSGHPHLWHTHFREIKYKDRGTQTPGPALSLGNGMLPFGLAEEPRRLFHGNAAFRLH
FPAHFERVGEAMPEDQQGQADRHHQWPSVEAQIGQKLQMIGDQFHQEHVQQHHRNQRWRRQPFLWRLAFALYTLIFERDA
VGVQGRGLEQR
© 1998-2022Legal notice