Dataset for protein classical BH3-containing proteins of organism Delphinapterus leucas

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
        mf aaae l  d daacgalrcpaeag cgaaecg p   a  aal aac c                    

        90       100       110       120       130       140       150       160
                    apta pa taalgm-rwrvrksmc rgp adgd                           
                                 a  rpgg ra  c                                  

       170       180       190       200       210       220       230       240
appaspgpfatrsplfifvrrssllsrsssgyfsfdtdr-pa-mscdkstqt pavgql--g-----------qavpadm
                                     qp ls aeqhleslv eve  isg-rtqlrsgvagle      
                                                          caa p g ap a  e       

       250       260       270       280       290       300       310
            :. :.*.::                                                 
rp-i-are--aefkama kfhqrt---vflnnh--------m--l-------qvlnllswlrgsrtmepn
   q    tg-r   l  d  flqmw rrars-repqqshr-ty-pw ynlimgalpiprglrrpnl   
                        e          eapral sp  v caaak  a aak f age    
© 1998-2021Legal notice