Dataset for protein classical BH3-containing proteins of organism Delphinapterus leucas

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2Y9PEE3_BBC3-01      MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAA
A0A2Y9Q753_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      --------MFPAAAVGVARTGDAACGALSCPAERGSGRAASCRLSAAPGA
A0A2Y9P485_PMAIP1-      --------------------------------------------------
A0A2Y9Q8G3_HRK-01       --------------------------------------------------
                                                                          

A0A2Y9PEE3_BBC3-01      PALLPAAYLC----------------------------------------
A0A2Y9Q753_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      PTASPGLCLPGRLRVDGQGAPGRRRARAGRRRAPARTRRSEGKGRTKKDQ
A0A2Y9P485_PMAIP1-      --------------------------------------------------
A0A2Y9Q8G3_HRK-01       --------------------------------------------------
                                                                          

A0A2Y9PEE3_BBC3-01      APTAPPAVTAALGAPRWPGGPRSRPRGPRPDGP-----------------
A0A2Y9Q753_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPISLQTERQGNPEGEGDR
A0A2Y9Q753_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPISLQTERQ---------
A0A2Y9P485_PMAIP1-      -------------MPGRRVRKSAQQSPTRAPAD-----------------
A0A2Y9Q8G3_HRK-01       ----------------------MCPCPLHRGRG-----------------
                                                    .                     

A0A2Y9PEE3_BBC3-01      -----------------------------------------------QPS
A0A2Y9Q753_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A2Y9Q753_BCL2L11      -----------------------------------------------DRS
A0A2Y9P485_PMAIP1-      --------------------------------------------------
A0A2Y9Q8G3_HRK-01       --------------------------------------------------
                                                                          

A0A2Y9PEE3_BBC3-01      LSPAEQHLESLVPSAPGALAGGPTQAAPGVRGEE--------EQWAREIG
A0A2Y9Q753_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIW---IA
A0A2Y9Q753_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIW---IA
A0A2Y9P485_PMAIP1-      ------------PEVECAI-------------------------------
A0A2Y9Q8G3_HRK-01       ------------PPAVCACSAGRLGLRSSAAQL---------------TA
                                    *                                     

A0A2Y9PEE3_BBC3-01      AQLRRMADDLNALYERR-----RQEEQQRHRPSPWRVLYNLIMGLLPLPR
A0A2Y9Q753_BCL2L11      QELRRIGDEFNAYYPRRVFLNNHQAAEGHPQMVILRLLRHIVRLVWRMQ-
A0A2Y9Q753_BCL2L11      QELRRIGDEFNAYYPRRVFLNNHQAAEGHPQMVILRLLRHIVRLVWRMQ-
A0A2Y9P485_PMAIP1-      -QFRRIGDKLNFRQ----------------------------KLLNLISK
A0A2Y9Q8G3_HRK-01       ARLKALGDELHQRTMWRRRARSRRAPAPSALPTYWPWLCAAAQVAALAAW
                          :. :.*.::                                       

A0A2Y9PEE3_BBC3-01      GRGAPEMEPN
A0A2Y9Q753_BCL2L11      ----------
A0A2Y9Q753_BCL2L11      ----------
A0A2Y9P485_PMAIP1-      LFRSGT----
A0A2Y9Q8G3_HRK-01       LLGRRNL---
                                  

© 1998-2020Legal notice