Dataset for protein classical BH3-containing proteins of organism Delphinapterus leucas

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A2Y9P485_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Delphinapterus leucas GN=PMAIP1 (length=54 residues).
MPGRRVRKSAQQSPTRAPADPEVECAIQFRRIGDKLNFRQKLLNLISKLFRSGT
>gnl|bcl2dbpro|A0A2Y9PEE3_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Delphinapterus leucas GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGAPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESLVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|A0A2Y9Q753_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Delphinapterus leucas GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPISLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNHQAAEGHPQMVILRLLRHIVRLVWRMQ
>gnl|bcl2dbpro|A0A2Y9Q753_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Delphinapterus leucas GN=BCL2L11 (length=232 residues).
MFPAAAVGVARTGDAACGALSCPAERGSGRAASCRLSAAPGAPTASPGLCLPGRLRVDGQGAPGRRRARAGRRRAPARTR
RSEGKGRTKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPISLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYL
SAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNHQAAEGHPQMVILRLLRHIVRLVWRMQ
>gnl|bcl2dbpro|A0A2Y9Q8G3_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Delphinapterus leucas GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPSALPTYWPWLCAAAQVAA
LAAWLLGRRNL
© 1998-2020Legal notice