Dataset for protein classical BH3-containing proteins of organism Danio rerio

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        * .  :.: ..         .          .     *.         :.:                     
-------sDtsetqtmrngpas---qhwtgshvvlqqttvpgrqpGerngrrrnrsmsqnqsrsygnae-----------
mahmfnmm edreevleksl--slskessppgqqkphlhldfppk sqlpmqlglhlqnhgllltmvrtlsvssssyrsv
      i  d  dd fae  qgdg kp galkikagefad la  gd llgci  needhfep    flrlaagsfaq

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    :  . . *                       . . * .*       ..:*. :.*:* .            .   :
-sdvvlgspvsP----------------------rsrsaP-pAlwvetvygqqLrrigDeFyrlymmr-------rqrsq
pppsmprqnlr niseaqdgqndevwlsehshqhmqmpe va qspamlvark qlms q nqgqikhvksvntlhappe
dd h   d fm                       le a  r   pa kki  e        dkehceagagagqa  mn 

       170       180       190 
....:....|....:....|....:....|.
 .   *       *. ::  .          
sp--lW--v----Lvllfsrre---------
haivs rr-itgv thfwlhkrsrresrpae
d     mn aiar af  ga  nda      
© 1998-2022Legal notice