Dataset for protein classical BH3-containing proteins of organism Danio rerio

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


B2KKY9_BCL2L11-01      ------MSDTSREQTLANGPASQGSGESTGGGVVLPAGHFDFPQPGEGDP
A7MCM4_BAD-01          MAHMFNISDDSETETMEDSEASSLDKHKSGSAQKKQHLTVPDRLKGEQLG
Q0GKC7_BMF-01          -------MDEDEDDVFRKGL-----QHWPPPHLQIKQTELAGRPAGSRNG
                               * .  :.: ..         .          .     *.   

B2KKY9_BCL2L11-01      LRGGISMSNNQSRSPMNRTFSRSSSGYFSVDSDSVPGSPLMPNISEAQDG
A7MCM4_BAD-01          RQRNLSMNEEDLLETGVAE------------DPHMLGDPFRP--------
Q0GKC7_BMF-01          MLLCRHLQQHGHFLYGNAELLVLAASSRAQPPDVVLRQNVSP--------
                             :.:                         :  . . *        

B2KKY9_BCL2L11-01      QNDEVWLSEHSHQHLQMAAPVAALPPEMVVARELRRIGDEFNRLYCEAGA
A7MCM4_BAD-01          --------------RSRSAP-PALWAAKKYGQQLRRMSDEFDKGQMKRVK
Q0GKC7_BMF-01          --------------MERPEPRPAQSVETLIGQKLQLIGDQFYQEHIMH--
                                      . . * .*       ..:*. :.*:* .       

B2KKY9_BCL2L11-01      GVNQLRAPNEHAIVLWMNVIIGRLVHFFLRRR---------
A7MCM4_BAD-01          SAGTARQMSQSP--SW-------LAFLWSHKESDAESRPAE
Q0GKC7_BMF-01          -----HQRPQDP--LWRRVATAVLTLLFGARENRR------
                            .   : .   *       *. ::  .          

© 1998-2022Legal notice