Dataset for protein classical BH3-containing proteins of organism Danio rerio

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A7MCM4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Danio rerio GN=BAD (length=147 residues).
MAHMFNISDDSETETMEDSEASSLDKHKSGSAQKKQHLTVPDRLKGEQLGRQRNLSMNEEDLLETGVAEDPHMLGDPFRP
RSRSAPPALWAAKKYGQQLRRMSDEFDKGQMKRVKSAGTARQMSQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|B2KKY9_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Danio rerio GN=BCL2L11 (length=176 residues).
MSDTSREQTLANGPASQGSGESTGGGVVLPAGHFDFPQPGEGDPLRGGISMSNNQSRSPMNRTFSRSSSGYFSVDSDSVP
GSPLMPNISEAQDGQNDEVWLSEHSHQHLQMAAPVAALPPEMVVARELRRIGDEFNRLYCEAGAGVNQLRAPNEHAIVLW
MNVIIGRLVHFFLRRR
>gnl|bcl2dbpro|Q0GKC7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Danio rerio GN=BMF (length=142 residues).
MDEDEDDVFRKGLQHWPPPHLQIKQTELAGRPAGSRNGMLLCRHLQQHGHFLYGNAELLVLAASSRAQPPDVVLRQNVSP
MERPEPRPAQSVETLIGQKLQLIGDQFYQEHIMHHQRPQDPLWRRVATAVLTLLFGARENRR
© 1998-2022Legal notice