Dataset for protein classical BH3-containing proteins of organism Cyprinus carpio

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------------------------mde--tse
mslrtpspvpsvcevevicccastrhstgacqdssrnpnraspkhrdpehpedctptdsknrltmaqmfsisdnqtlded
 nhlff lcaa                                  mcinenainlvflltcs     dsdtare-seang
                                                                        --k  ---
                                                                             hdh
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
dvhrsgltkwpsgrvqrkq-----------------tlsmnre--sp------r-----f------l-l-p---sqpedg
preek-qqhnngssplltehvavpdrlkgeqlgrhrnetageapv--svmlpc-vptrl-ygssgs-l-s-psrdllptv
-as-gtgesag--a----- fdf qpse dp rggism-nshqsrl msrtfs sssgylsvdadlvpsarlmpnisqaq
q--s- -----k -eeiin                 --g----qt  nispqg  r     slitvyyvt wqlte hrs
 dy n  nnkk                          h qhqd                  me q  m   rlea     
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                ..:*. :.* :                                     
alren------p--rrvrsaap-palwaekkygqqLrrigDeF--dilldkgmkr---agttvq-rqspswlailws---
vadqgdlvggd-frlhsmeppar-ersvatliark qlms qlyqehmmcq-ng-vks---ar-mhapnevatfi-mhke
ddqndevwfdegshqamqmssqvglmgpvmav  e   v  l   nr-y--sa-ksaglnn--wlqvnyahyilvt-lrk
 s---nggt   lpv g rqq pa qak vec             --w-str-v  w gsgpsiwnwlsrlqmyriw   
 fv e         f                               t  hsqwq    irecl hgrkmqknk kgr   
                                                  h en      a      dlnice  fk   
                                                                   ag       g   

       250     
....:....|....:
               
sdaesrpae------
nsligtvvrrflrrr
rqfvass-qfemkv 
qptlwkes-s g e 
lnig   nme     
fe d   k       
e      c       
© 1998-2023Legal notice