Dataset for protein classical BH3-containing proteins of organism Cyprinus carpio

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mslrtpspcpsvcvcvcvcvcvcvcvcvcvrererererererererererererevevicccastrhstgacqdssrnp
 nhlffclvaaai                                          nlvfllt sa p      y    s 
 m icmtinen                                                n s                  
     v v vc                                                                     
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------mde--rltmaqmfslsdnessretskdtetsgqtknnpgs-pqrrvh-avprrlygeqllrh
nraspkhrdpvhpedctpt--kndeddvhrkgiqhwpkeqvqieqrqeahrapvssnvmlpckq-v-p-dlfksnaggll
     nt kterr     - stl--hqd---twnnkkr-ttelinphgq-gdqtlgsisvlgterle-t-fseissqvyt
          d         nr hd---yss----t--g-gltnkndsr -gesa-dgaqetnslfdfrqp t dprrgm
                    k    mnidpnxm r-s  s--a-g-a-- l---- --lm i   ylt  k   lh wag
                    l    i  stv d   a  h  -d-c-d                   l         s f
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                             ..:
rnlsmnseppletlrad-g-l-gg-pfrrrsrsapp---------------------------------alwaakkygqq
laswsreqdldvvgaqne-d-v--d-ldmme----almpniseaqddqndevwfdepshqhvqmaapvgersvetliark
vsrpqearsqhgasveenrgtsdylsv-gddqasr-                                 -egk-mav  e
i plgsh  rspma tfsdssr vf - s--pp s                                  vm-p --c   
  mrn q    q   v     g av   -  v                                      - -       
  v r d                     p                                                   
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300    
....:....|....:....|....:....|....:....|....:....|....:....|....
*. :.* :                                                        
LrrmsDeFd-lldkgmkrvksagt---m------rqspswlaflwshk----esdaesrp----
 qlig ql-iyqehmevk--nnqrtrq-replwwqvyravftlvfgreesdaaeatrn-raekv
   v  l ntwycq-ahhrvrsnkqlhlsncsshhtalgiysiki-pv    vverses-tn  
         r---- -ssgg--avswsnpvevicnalmilnndi-rep    fqsglrmssm  
         v      gaaaqw--   igga   gwiir mk gtkqs    klqfackhf   
                -- c qk    a d     svyn cm  a lr    igf pl      
                dt    i    c a     rkwm ae     n    c   ng      
                 q                  dt   c              d       
                                     g                          
© 1998-2022Legal notice