Dataset for protein classical BH3-containing proteins of organism Cyprinus carpio

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A8C1K489_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyprinus carpio GN=BAD (length=169 residues).
MCINENAINLVFLLTCSLTMAQMFSISDNESETSEDREESGQTKNNSGSPQRKQHVAVPDRLKGEQLGRHRNLSMNEEDL
LETGAADEGDLVGGDPFRRRSRSAPPALWAAKKYGQQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKE
SDAESRPAE
>gnl|bcl2dbpro|A0A8C1K489_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyprinus carpio GN=BAD (length=214 residues).
MSHRTPSPVASVCEVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPEHPEDCTPTDSKNRLTMAQMFSISDNESETSE
DREESGQTKNNSGSPQRKQHVAVPDRLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPPALWAAKKYG
QQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|A0A8C1K489_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyprinus carpio GN=BAD (length=214 residues).
MNLLFFSLCPAVCEVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPEHPEDCTPTDSKNRLTMAQMFSISDNESETSE
DREESGQTKNNSGSPQRKQHVAVPDRLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPPALWAAKKYG
QQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|A0A8C1NLV0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyprinus carpio GN=BAD (length=147 residues).
MDKTLHDHQDYSNTLNNKKKGREEIINTHGQHQDQTLPNISPQGRVRLYSESQVYMVSRWQEAEPQDGASVEENGGTGDG
LPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGEVKRVNSQKQTYRGWFSFLWSPKEEEGRE
>gnl|bcl2dbpro|A0A8C1P2N8_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Cyprinus carpio GN=BMF (length=140 residues).
MDEDEDDVHRKGLQHWPSSRVQLKQTETAGRAPVSPSVMLPCRVPTRLFYGSAGLLLLAPPSRSQPPDVVLRQNLRMMEP
AARPERSVETLIGQKLQLIGDQFYQEHMMSSSNNRLSGCSQALMAINKIVEPFVSTSCRS
>gnl|bcl2dbpro|A0A8C1P2N8_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Cyprinus carpio GN=BMF (length=144 residues).
MDEDEDDVHRKGLQHWPSSRVQLKQTETAGRAPVSPSVMLPCRVPTRLFYGSAGLLLLAPPSRSQPPDVVLRQNLRMMEP
AARPERSVETLIGQKLQLIGDQFYQEHMMHHRNQRIREPLWWRVALAVYTLVFGREAEARENRR
>gnl|bcl2dbpro|A0A8C1P2N8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Cyprinus carpio GN=BMF (length=151 residues).
MDEDEDDVHRKGLQHWPSSRVQLKQTETAGRAPVSPSVMLPCRVPTRLFYGSAGLLLLAPPSRSQPPDVVLRQNLRMMEP
AARPERSVETLIGQKLQLIGDQFYQEHMMDTQWKKSWSLGAAVIHGRDGNVCMIKTRQNIGATPSMRFMKV
>gnl|bcl2dbpro|A0A8C1Q8B2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Cyprinus carpio GN=PMAIP1 (length=72 residues).
MLITSLYLTPRLLTILHRSAFVAVRRSQQPPLQAAVVECAQELRRVGDLLNWKYRLLELIIKLRKLQTDGKS
>gnl|bcl2dbpro|A0A8C1RI29_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Cyprinus carpio GN=BCL2L11 (length=181 residues).
DSDTAREQTLANGPASRGGGESAGGGAVLRTEHFDFPQPSEGDPLRGGISMSNSHQSRSPMSRTFSRSSSGYFSVDSDSV
PSSPLMPNISEAQDDQNDEVWFDEPSHQHVQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNNAVQLHAPNEH
AIIIWMNDLIGRVVQFFLRRR
>gnl|bcl2dbpro|A0A8C1RI29_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Cyprinus carpio GN=BCL2L11 (length=181 residues).
MSDTSREQTLANGPASRGGGESAGGGAVLRTEHFDFPQPSEGDPLRGGISMSNSHQSRSPMSRTFSRSSSGYFSVDSDSV
PSSPLMPNISEAQDDQNDEVWFDEPSHQHVQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNNAVQLHAPNEH
AIIIWMNDLIGRVVQFFLRRR
© 1998-2023Legal notice