Dataset for protein classical BH3-containing proteins of organism Cyprinus carpio

[Download (right click)] [Edit] [Sequences] [Repertoires]

24 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C1Q8B2_PMAIP1-      --------------------------------------------------
A0A8C1RI29_BCL2L11      --------------------------------------------------
A0A8C1RI29_BCL2L11      --------------------------------------------------
A0A8C1K489_BAD-02       -----MCINENAI-------------------------------------
A0A8C2EZI8_BAD-02       -----MCINENAI-------------------------------------
A0A8C1T162_BAD-01       -MLICVCVCVCVCVCVCVCVCVCVCVCVCVRERERERERERERERERERE
A0A8C2A067_BAD-02       MNLLFFTLCPAVC-------------------------------------
A0A8C2EZI8_BAD-03       MNLLFFTLCPAVC-------------------------------------
A0A8C2A067_BAD-01       MSHRTPSPVASVC-------------------------------------
A0A8C2EZI8_BAD-01       MSHRTPSPVASVC-------------------------------------
A0A8C1K489_BAD-03       MNLLFFSLCPAVC-------------------------------------
A0A8C1K489_BAD-01       MSHRTPSPVASVC-------------------------------------
A0A8C1FL78_BAD-01       --------------------------------------------------
A0A8C2JBT6_BAD-01       --------------------------------------------------
A0A8C1NLV0_BAD-01       --------------------------------------------------
A0A8C2Q444_BAD-01       --------------------------------------------------
A0A8C1P2N8_BMF-01       --------------------------------------------------
A0A8C1P2N8_BMF-02       --------------------------------------------------
A0A8C1P2N8_BMF-03       --------------------------------------------------
A0A8C1XUF5_BMF-01       --------------------------------------------------
A0A8C2DDJ7_BMF-01       --------------------------------------------------
A0A8C1UAR1_BMF-01       --------------------------------------------------
A0A8C1UAR1_BMF-02       --------------------------------------------------
A0A8C2DDJ7_BMF-02       --------------------------------------------------
                                                                          

A0A8C1Q8B2_PMAIP1-      --------------------------------------------------
A0A8C1RI29_BCL2L11      --------------------------------------------------
A0A8C1RI29_BCL2L11      --------------------------------------------------
A0A8C1K489_BAD-02       -----NLVFLLTCS------------------------------------
A0A8C2EZI8_BAD-02       -----NLVFLLTCS------------------------------------
A0A8C1T162_BAD-01       RERERELEVNCSCAATPHSTGACYDSSRSPNRASPNTRKTVRR---TPTD
A0A8C2A067_BAD-02       -----EVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPVHPEDCTPTD
A0A8C2EZI8_BAD-03       -----EVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPDHPEDCTPTD
A0A8C2A067_BAD-01       -----EVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPVHPEDCTPTD
A0A8C2EZI8_BAD-01       -----EVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPDHPEDCTPTD
A0A8C1K489_BAD-03       -----EVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPEHPEDCTPTD
A0A8C1K489_BAD-01       -----EVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPEHPEDCTPTD
A0A8C1FL78_BAD-01       ------------------------------------------------MD
A0A8C2JBT6_BAD-01       ------------------------------------------------MD
A0A8C1NLV0_BAD-01       ------------------------------------------------MD
A0A8C2Q444_BAD-01       ------------------------------------------------MD
A0A8C1P2N8_BMF-01       ------------------------------------------------MD
A0A8C1P2N8_BMF-02       ------------------------------------------------MD
A0A8C1P2N8_BMF-03       ------------------------------------------------MD
A0A8C1XUF5_BMF-01       --------------------------------------------------
A0A8C2DDJ7_BMF-01       ------------------------------------------------MD
A0A8C1UAR1_BMF-01       ------------------------------------------------MD
A0A8C1UAR1_BMF-02       ------------------------------------------------MD
A0A8C2DDJ7_BMF-02       ------------------------------------------------MD
                                                                          

A0A8C1Q8B2_PMAIP1-      ---------------------------------------MLITSLYLTPR
A0A8C1RI29_BCL2L11      ------------DSDTAREQTLANGPASRGGGESAGGGAVLRTEHFDFPQ
A0A8C1RI29_BCL2L11      ------------MSDTSREQTLANGPASRGGGESAGGGAVLRTEHFDFPQ
A0A8C1K489_BAD-02       ----LTMAQMFSISDNES--ETSEDREESGQTKNNSGS-PQRKQHVAVPD
A0A8C2EZI8_BAD-02       ----LTMAQMFSISDNESETETSEDREESGQTKNNSGS-PQRKQHLAVPD
A0A8C1T162_BAD-01       LRNRLIMAHMFSISDNESESETSDDCEDSGLTKNNSGSLQETNQRLALPQ
A0A8C2A067_BAD-02       SKNRLTMAQMFSISDNESETETSEDREESGQTKNNSGS-PQRKQHLAVPD
A0A8C2EZI8_BAD-03       SKNRLTMAQMFSISDNESETETSEDREESGQTKNNSGS-PQRKQHLAVPD
A0A8C2A067_BAD-01       SKNRLTMAQMFSISDNESETETSEDREESGQTKNNSGS-PQRKQHLAVPD
A0A8C2EZI8_BAD-01       SKNRLTMAQMFSISDNESETETSEDREESGQTKNNSGS-PQRKQHLAVPD
A0A8C1K489_BAD-03       SKNRLTMAQMFSISDNES--ETSEDREESGQTKNNSGS-PQRKQHVAVPD
A0A8C1K489_BAD-01       SKNRLTMAQMFSISDNES--ETSEDREESGQTKNNSGS-PQRKQHVAVPD
A0A8C1FL78_BAD-01       NTLHDHQDDPSTWNNKKKGRGETIKNQGQHQDQTLPNISPQGRV------
A0A8C2JBT6_BAD-01       NTLHDHQDDPSTWNNKKKGRGETIKNQGQHQDQTLPNISPQGRV------
A0A8C1NLV0_BAD-01       KTLHDHQDYSNTLNNKKKGREEIINTHGQHQDQTLPNISPQGRV------
A0A8C2Q444_BAD-01       KTLHDHQDYSNTLNDKKKGREEIINTHGQHQDQTLPNISPQGRV------
A0A8C1P2N8_BMF-01       E--DEDDVHRKGLQHWPSSRVQLKQTETAGRAPVSPSVMLPCRV---PTR
A0A8C1P2N8_BMF-02       E--DEDDVHRKGLQHWPSSRVQLKQTETAGRAPVSPSVMLPCRV---PTR
A0A8C1P2N8_BMF-03       E--DEDDVHRKGLQHWPSSRVQLKQTETAGRAPVSPSVMLPCRV---PTR
A0A8C1XUF5_BMF-01       -----MNISTVXLQRWPSSHVQLKQTETAGRAPVSPSVMLPCRV---PTR
A0A8C2DDJ7_BMF-01       E--DEDDVHRKGLQHWPSSQVQIKQTETAGRAPVSPNSMLPCRVHVEPRR
A0A8C1UAR1_BMF-01       E--DEDDVHRKGLQHWPSSQVQIKQTDTAGRAPVSPDSMLPCRVHVEPRR
A0A8C1UAR1_BMF-02       E--DEDDVHRKGLQHWPSSQVQIKQTDTAGRAPVSPDSMLPCRVHVEPRR
A0A8C2DDJ7_BMF-02       E--DEDDVHRKGLQHWPSSQVQIKQTETAGRAPVSPNSMLPCRVHVEPRR
                                                                          

A0A8C1Q8B2_PMAIP1-      LLTILHRSAFVAVRRSQQPPLQAAVVE-----------------------
A0A8C1RI29_BCL2L11      PSEGDPLRGGISMSNSHQSRSPMSRTFSRSSSGYFSVDSDSVPSSPLMPN
A0A8C1RI29_BCL2L11      PSEGDPLRGGISMSNSHQSRSPMSRTFSRSSSGYFSVDSDSVPSSPLMPN
A0A8C1K489_BAD-02       RLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPP----
A0A8C2EZI8_BAD-02       RLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPP----
A0A8C1T162_BAD-01       KLKGEQLWRHRNLSMNDEDLLETGAADEDDLVGGVPFRPRSRSAPP----
A0A8C2A067_BAD-02       RLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPP----
A0A8C2EZI8_BAD-03       RLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPP----
A0A8C2A067_BAD-01       RLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPP----
A0A8C2EZI8_BAD-01       RLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPP----
A0A8C1K489_BAD-03       RLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPP----
A0A8C1K489_BAD-01       RLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPP----
A0A8C1FL78_BAD-01       RLYSESQVYTVSRWQEAEPQDGALVEENGGLRDALSFRGRSQSAPA----
A0A8C2JBT6_BAD-01       RLYSESQVYTVSRWQEAEPQDGALVEENGGLRDVLSFRGRSQSAPA----
A0A8C1NLV0_BAD-01       RLYSESQVYMVSRWQEAEPQDGASVEENGGTGDGLPFRGRSQSAPA----
A0A8C2Q444_BAD-01       RLYSESQVYMVSRWQEAEPQDGASVEENGGTGDGLPFRGRSQSAPA----
A0A8C1P2N8_BMF-01       LFYGSAGLLLLAPPSRSQPPDVVLRQN---------LRMMEPAARP----
A0A8C1P2N8_BMF-02       LFYGSAGLLLLAPPSRSQPPDVVLRQN---------LRMMEPAARP----
A0A8C1P2N8_BMF-03       LFYGSAGLLLLAPPSRSQPPDVVLRQN---------LRMMEPAARP----
A0A8C1XUF5_BMF-01       LFYGNAGLLLLAPPSRSQPPDVVLRQN---------LRMMEPAARP----
A0A8C2DDJ7_BMF-01       FLYGNAGLLLLASLGRSRPPHVVLRQN---------LRMMD----P----
A0A8C1UAR1_BMF-01       FLYGNAGLLLLASLGRSRPPHVVLRQN---------LRMMD----P----
A0A8C1UAR1_BMF-02       FLYGNAGLLLLASLGRSRPPHVVLRQN---------LRMMD----P----
A0A8C2DDJ7_BMF-02       FLYGNAGLLLLASLGRSRPPHVVLRQN---------LRMMD----P----
                                                                          

A0A8C1Q8B2_PMAIP1-      ------------------------------------CAQELRRVGDLL--
A0A8C1RI29_BCL2L11      ISEAQDDQNDEVWFDEPSHQHVQMAAPVGAMGPEMAVARELRRIGDEFNR
A0A8C1RI29_BCL2L11      ISEAQDDQNDEVWFDEPSHQHVQMAAPVGAMGPEMAVARELRRIGDEFNR
A0A8C1K489_BAD-02       -----------------------------ALWAAKKYGQQLRRMSDEFDI
A0A8C2EZI8_BAD-02       -----------------------------ALWAAKKYGQQLRRMSDEFDI
A0A8C1T162_BAD-01       -----------------------------ALWAAKKYGQQLRRMSDEFDV
A0A8C2A067_BAD-02       -----------------------------ALWAAKKYGQQLRRMSDEFDI
A0A8C2EZI8_BAD-03       -----------------------------ALWAAKKYGQQLRRMSDEFDI
A0A8C2A067_BAD-01       -----------------------------ALWAAKKYGQQLRRMSDEFDI
A0A8C2EZI8_BAD-01       -----------------------------ALWAAKKYGQQLRRMSDEFDI
A0A8C1K489_BAD-03       -----------------------------ALWAAKKYGQQLRRMSDEFDI
A0A8C1K489_BAD-01       -----------------------------ALWAAKKYGQQLRRMSDEFDI
A0A8C1FL78_BAD-01       -----------------------------ALWKAKKYGRQLRRMSDEFDT
A0A8C2JBT6_BAD-01       -----------------------------ALWKAKKYGRQLRRMSDEFDT
A0A8C1NLV0_BAD-01       -----------------------------ALWKAKKYGRQLRRMSDEFDT
A0A8C2Q444_BAD-01       -----------------------------VLWKAKKYGRQLRRMSDEFDT
A0A8C1P2N8_BMF-01       -----------------------------ERSVETLIGQKLQLIGDQF--
A0A8C1P2N8_BMF-02       -----------------------------ERSVETLIGQKLQLIGDQF--
A0A8C1P2N8_BMF-03       -----------------------------ERSVETLIGQKLQLIGDQF--
A0A8C1XUF5_BMF-01       -----------------------------ERSVETLIGQKLQLIGDQF--
A0A8C2DDJ7_BMF-01       -----------------------------EESVETLIGQKLQLIGDQF--
A0A8C1UAR1_BMF-01       -----------------------------EESVETLIGQKLQLIGDQF--
A0A8C1UAR1_BMF-02       -----------------------------EESVETLIGQKLQLIGDQF--
A0A8C2DDJ7_BMF-02       -----------------------------EESVETLIGQKLQLIGDQF--
                                                             ..:*. :.* :  

A0A8C1Q8B2_PMAIP1-      ------------------------NWKYRLLELIIKLR----KLQTDGKS
A0A8C1RI29_BCL2L11      LYCQGAGAGGNNAVQLHAPNE---HAIIIWMNDLIGRV----VQFFLRRR
A0A8C1RI29_BCL2L11      LYCQGAGAGGNNAVQLHAPNE---HAIIIWMNDLIGRV----VQFFLRRR
A0A8C1K489_BAD-02       LLDKGMKRVKSAGTTRQM------RQSPSWLAFLWSHK----ESDAESRP
A0A8C2EZI8_BAD-02       LLDKGMKRVKSAGTTRQM------RQSPSWLAFLWSHK----ESDAESRP
A0A8C1T162_BAD-01       LLDKGMKRVKSAGTTRQM------RQSTSWFAFLWSHKESDAESDAESRH
A0A8C2A067_BAD-02       LLDKGMKRVKSAGTTRQM------RQSPSWLAFLWSHK----ESDAESRP
A0A8C2EZI8_BAD-03       LLDKGMKRVKSAGTTRQM------RQSPSWLAFLWSHK----ESDAESRP
A0A8C2A067_BAD-01       LLDKGMKRVKSAGTTRQM------RQSPSWLAFLWSHK----ESDAESRP
A0A8C2EZI8_BAD-01       LLDKGMKRVKSAGTTRQM------RQSPSWLAFLWSHK----ESDAESRP
A0A8C1K489_BAD-03       LLDKGMKRVKSAGTTRQM------RQSPSWLAFLWSHK----ESDAESRP
A0A8C1K489_BAD-01       LLDKGMKRVKSAGTTRQM------RQSPSWLAFLWSHK----ESDAESRP
A0A8C1FL78_BAD-01       WLDKGEVKRANSQK----------QTYRGWFSFLWSPK----EEEGRE--
A0A8C2JBT6_BAD-01       WLDKGEVKRANSQK----------QTYRGWFSFLWSPK----EEEGRE--
A0A8C1NLV0_BAD-01       WLDKGEVKRVNSQK----------QTYRGWFSFLWSPK----EEEGRE--
A0A8C2Q444_BAD-01       WLDKGEVKRVNSQK----------QTYRGWFSFLWSPK----EEEGRE--
A0A8C1P2N8_BMF-01       YQEHMMDT--QWKKSWSLGAAVIHGRDGNVCMIKTRQN----IGATPSMR
A0A8C1P2N8_BMF-02       YQEHMMSS--SNNR---LSGCS--QALMAINKIV--EP----FVSTSCRS
A0A8C1P2N8_BMF-03       YQEHMMHH--RNQR---IREPLWWRVALAVYTLVFGRE----AEARENRR
A0A8C1XUF5_BMF-01       YQEHMMHH--RNQR---IREPLWWRVALAVYTLVFGRE----AEARENRR
A0A8C2DDJ7_BMF-01       YQEHMMKQACSQIR---CRVCLSCRSVWMVACLGAGRS----CSQTNLSS
A0A8C1UAR1_BMF-01       YQEHMMSS--SNNR---LSDCS--QALMAINKIV--EP----FVSTSCRS
A0A8C1UAR1_BMF-02       YQEHMMHH--RNQR---NREPLWWRVALAVYTLLFGRE----AEARANRR
A0A8C2DDJ7_BMF-02       YQEHMMHH--RNQR---NREPLWWRVALAVYTLLFGRE----AEARANRR
                                                                          

A0A8C1Q8B2_PMAIP1-      ----
A0A8C1RI29_BCL2L11      ----
A0A8C1RI29_BCL2L11      ----
A0A8C1K489_BAD-02       AE--
A0A8C2EZI8_BAD-02       AE--
A0A8C1T162_BAD-01       TE--
A0A8C2A067_BAD-02       AE--
A0A8C2EZI8_BAD-03       AE--
A0A8C2A067_BAD-01       AE--
A0A8C2EZI8_BAD-01       AE--
A0A8C1K489_BAD-03       AE--
A0A8C1K489_BAD-01       AE--
A0A8C1FL78_BAD-01       ----
A0A8C2JBT6_BAD-01       ----
A0A8C1NLV0_BAD-01       ----
A0A8C2Q444_BAD-01       ----
A0A8C1P2N8_BMF-01       FMKV
A0A8C1P2N8_BMF-02       ----
A0A8C1P2N8_BMF-03       ----
A0A8C1XUF5_BMF-01       ----
A0A8C2DDJ7_BMF-01       SN--
A0A8C1UAR1_BMF-01       ----
A0A8C1UAR1_BMF-02       ----
A0A8C2DDJ7_BMF-02       ----
                            

© 1998-2022Legal notice