Dataset for protein classical BH3-containing proteins of organism Cyprinus carpio

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C1Q8B2_PMAIP1-      --------------------------------------------------
A0A8C1K489_BAD-01       MSHRTPSPVASVCEVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPEH
A0A8C1K489_BAD-03       MNLLFFSLCPAVCEVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPEH
A0A8C1NLV0_BAD-01       --------------------------------------------------
A0A8C1P2N8_BMF-01       --------------------------------------------------
A0A8C1P2N8_BMF-02       --------------------------------------------------
A0A8C1P2N8_BMF-03       --------------------------------------------------
A0A8C1RI29_BCL2L11      --------------------------------------------------
A0A8C1RI29_BCL2L11      --------------------------------------------------
A0A8C1K489_BAD-02       ---------------------------------------------MCINE
                                                                          

A0A8C1Q8B2_PMAIP1-      --------------------------------------------------
A0A8C1K489_BAD-01       PEDCTPTDSKNRLTMAQMFSISDNESETSEDREESGQTKNNSGSPQRKQH
A0A8C1K489_BAD-03       PEDCTPTDSKNRLTMAQMFSISDNESETSEDREESGQTKNNSGSPQRKQH
A0A8C1NLV0_BAD-01       ----------------------MDKTLHDHQDYSNTLNNKKKGREEIIN-
A0A8C1P2N8_BMF-01       ----------------------MDE--DEDDVHRKGLQHWPSSRVQLKQ-
A0A8C1P2N8_BMF-02       ----------------------MDE--DEDDVHRKGLQHWPSSRVQLKQ-
A0A8C1P2N8_BMF-03       ----------------------MDE--DEDDVHRKGLQHWPSSRVQLKQ-
A0A8C1RI29_BCL2L11      -----------------DSDTAREQTLANGPASRGGGESAGGGAVLRTEH
A0A8C1RI29_BCL2L11      -----------------MSDTSREQTLANGPASRGGGESAGGGAVLRTEH
A0A8C1K489_BAD-02       NAINLVFLLTCSLTMAQMFSISDNESETSEDREESGQTKNNSGSPQRKQH
                                                                          

A0A8C1Q8B2_PMAIP1-      -----------------------------------------MLITSLYLT
A0A8C1K489_BAD-01       VAVPDRLKGEQLGRHRNLSMNEE---------------------------
A0A8C1K489_BAD-03       VAVPDRLKGEQLGRHRNLSMNEE---------------------------
A0A8C1NLV0_BAD-01       ----------------THGQHQDQTLPNISPQGRVR---LYSESQVYMVS
A0A8C1P2N8_BMF-01       ----------------TETAGRAPVSPSVMLPCRVPTRLFYGSAGLLLLA
A0A8C1P2N8_BMF-02       ----------------TETAGRAPVSPSVMLPCRVPTRLFYGSAGLLLLA
A0A8C1P2N8_BMF-03       ----------------TETAGRAPVSPSVMLPCRVPTRLFYGSAGLLLLA
A0A8C1RI29_BCL2L11      FDFPQPSEGDPLRGGISMSNSHQSRSPMSRTFSRSSSGYFSVDSDSVPSS
A0A8C1RI29_BCL2L11      FDFPQPSEGDPLRGGISMSNSHQSRSPMSRTFSRSSSGYFSVDSDSVPSS
A0A8C1K489_BAD-02       VAVPDRLKGEQLGRHRNLSMNEE---------------------------
                                                                          

A0A8C1Q8B2_PMAIP1-      PRLLTILHRSAF------------VAVRRSQQPPLQAAVVECAQELRRVG
A0A8C1K489_BAD-01       ----DLLETGAADEGDLVGGDPFRRRSRSAPP--ALWAAKKYGQQLRRMS
A0A8C1K489_BAD-03       ----DLLETGAADEGDLVGGDPFRRRSRSAPP--ALWAAKKYGQQLRRMS
A0A8C1NLV0_BAD-01       RWQEAEPQDGASVEENGGTGDGLPFRGRSQSAPAALWKAKKYGRQLRRMS
A0A8C1P2N8_BMF-01       PPSRSQPPDVVLRQN---------LRMMEPAARPERSVETLIGQKLQLIG
A0A8C1P2N8_BMF-02       PPSRSQPPDVVLRQN---------LRMMEPAARPERSVETLIGQKLQLIG
A0A8C1P2N8_BMF-03       PPSRSQPPDVVLRQN---------LRMMEPAARPERSVETLIGQKLQLIG
A0A8C1RI29_BCL2L11      PLMPNISEAQDDQNDEVWFDEPSHQHVQMAAPVGAMGPEMAVARELRRIG
A0A8C1RI29_BCL2L11      PLMPNISEAQDDQNDEVWFDEPSHQHVQMAAPVGAMGPEMAVARELRRIG
A0A8C1K489_BAD-02       ----DLLETGAADEGDLVGGDPFRRRSRSAPP--ALWAAKKYGQQLRRMS
                                                                  ..:*. :.

A0A8C1Q8B2_PMAIP1-      DLL----------------------NWKYRLLELIIKLRKLQTDGKS---
A0A8C1K489_BAD-01       DEF--DILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAESRPAE-
A0A8C1K489_BAD-03       DEF--DILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAESRPAE-
A0A8C1NLV0_BAD-01       DEF--DTWLDKGEVK----------RVNSQKQTYRGW---FSFLWSPKEE
A0A8C1P2N8_BMF-01       DQFYQEHMMDTQWKKSWSLGAAVIHGRDGNVCMIKTR---QNIGATPSMR
A0A8C1P2N8_BMF-02       DQFYQEHMMSSSNNR---LSGCS--QALMAINKIV-----EPFVSTSCRS
A0A8C1P2N8_BMF-03       DQFYQEHMMHHRNQR---IREPLWWRVALAVYTLVFG---REAEARENRR
A0A8C1RI29_BCL2L11      DEF--NRLYCQGAG--AGGNNAVQLHAPNEHAIIIWM---NDLIGRVVQF
A0A8C1RI29_BCL2L11      DEF--NRLYCQGAG--AGGNNAVQLHAPNEHAIIIWM---NDLIGRVVQF
A0A8C1K489_BAD-02       DEF--DILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAESRPAE-
                        * :                                               

A0A8C1Q8B2_PMAIP1-      -----
A0A8C1K489_BAD-01       -----
A0A8C1K489_BAD-03       -----
A0A8C1NLV0_BAD-01       EGRE-
A0A8C1P2N8_BMF-01       FMKV-
A0A8C1P2N8_BMF-02       -----
A0A8C1P2N8_BMF-03       -----
A0A8C1RI29_BCL2L11      FLRRR
A0A8C1RI29_BCL2L11      FLRRR
A0A8C1K489_BAD-02       -----
                             

© 1998-2023Legal notice