Dataset for protein Bmf of organism Cyprinus carpio

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MDEDEDDVHRKGLQHWPSSRVQLKQTETAGRAPVSPSVMLPCRVPTRLFYGSAGLLLLAPPSRSQPPDVVLRQNLRMMEP
                                                                                
                                                                                

        90       100       110       120       130       140       150 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
*****************************   .:.   :           :  :       :         
AARPERSVETLIGQKLQLIGDQFYQEHMMstsnqr---lsgpv--rvlmavytiv--rpivatssrr----
                             hsrwnkswsirecswwqrdlninmlktrqnfgsrpnmsfmkv
                             dhq k     gaalihgaag  ck  fgeeae  ec      
© 1998-2023Legal notice