Dataset for protein Bmf of organism Cyprinus carpio

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C1P2N8_BMF-01      MDEDEDDVHRKGLQHWPSSRVQLKQTETAGRAPVSPSVMLPCRVPTRLFY
A0A8C1P2N8_BMF-02      MDEDEDDVHRKGLQHWPSSRVQLKQTETAGRAPVSPSVMLPCRVPTRLFY
A0A8C1P2N8_BMF-03      MDEDEDDVHRKGLQHWPSSRVQLKQTETAGRAPVSPSVMLPCRVPTRLFY
                       **************************************************

A0A8C1P2N8_BMF-01      GSAGLLLLAPPSRSQPPDVVLRQNLRMMEPAARPERSVETLIGQKLQLIG
A0A8C1P2N8_BMF-02      GSAGLLLLAPPSRSQPPDVVLRQNLRMMEPAARPERSVETLIGQKLQLIG
A0A8C1P2N8_BMF-03      GSAGLLLLAPPSRSQPPDVVLRQNLRMMEPAARPERSVETLIGQKLQLIG
                       **************************************************

A0A8C1P2N8_BMF-01      DQFYQEHMMDTQWKKSWSLGAAVIHGRDGNVCMIKTRQNIGATPSMRFMK
A0A8C1P2N8_BMF-02      DQFYQEHMMSSSNNR---LSGCS--QALMAINKIV--EPFVSTSCRS---
A0A8C1P2N8_BMF-03      DQFYQEHMMHHRNQR---IREPLWWRVALAVYTLVFGREAEARENRR---
                       *********   .:.   :           :  :       :        

A0A8C1P2N8_BMF-01      V
A0A8C1P2N8_BMF-02      -
A0A8C1P2N8_BMF-03      -
                        

© 1998-2023Legal notice