Dataset for protein Bmf of organism Cyprinus carpio

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C1P2N8_BMF-01      MDEDEDDVHRKGLQHWPSSRVQLKQTETAGRAPVSPSVMLPCRV---PTR
A0A8C1P2N8_BMF-02      MDEDEDDVHRKGLQHWPSSRVQLKQTETAGRAPVSPSVMLPCRV---PTR
A0A8C1P2N8_BMF-03      MDEDEDDVHRKGLQHWPSSRVQLKQTETAGRAPVSPSVMLPCRV---PTR
A0A8C1XUF5_BMF-01      -----MNISTVXLQRWPSSHVQLKQTETAGRAPVSPSVMLPCRV---PTR
A0A8C2DDJ7_BMF-01      MDEDEDDVHRKGLQHWPSSQVQIKQTETAGRAPVSPNSMLPCRVHVEPRR
A0A8C1UAR1_BMF-01      MDEDEDDVHRKGLQHWPSSQVQIKQTDTAGRAPVSPDSMLPCRVHVEPRR
A0A8C1UAR1_BMF-02      MDEDEDDVHRKGLQHWPSSQVQIKQTDTAGRAPVSPDSMLPCRVHVEPRR
A0A8C2DDJ7_BMF-02      MDEDEDDVHRKGLQHWPSSQVQIKQTETAGRAPVSPNSMLPCRVHVEPRR
                             ::    **.****.**:***:*********. ******   * *

A0A8C1P2N8_BMF-01      LFYGSAGLLLLAPPSRSQPPDVVLRQNLRMMEPAARPERSVETLIGQKLQ
A0A8C1P2N8_BMF-02      LFYGSAGLLLLAPPSRSQPPDVVLRQNLRMMEPAARPERSVETLIGQKLQ
A0A8C1P2N8_BMF-03      LFYGSAGLLLLAPPSRSQPPDVVLRQNLRMMEPAARPERSVETLIGQKLQ
A0A8C1XUF5_BMF-01      LFYGNAGLLLLAPPSRSQPPDVVLRQNLRMMEPAARPERSVETLIGQKLQ
A0A8C2DDJ7_BMF-01      FLYGNAGLLLLASLGRSRPPHVVLRQNLRMMD----PEESVETLIGQKLQ
A0A8C1UAR1_BMF-01      FLYGNAGLLLLASLGRSRPPHVVLRQNLRMMD----PEESVETLIGQKLQ
A0A8C1UAR1_BMF-02      FLYGNAGLLLLASLGRSRPPHVVLRQNLRMMD----PEESVETLIGQKLQ
A0A8C2DDJ7_BMF-02      FLYGNAGLLLLASLGRSRPPHVVLRQNLRMMD----PEESVETLIGQKLQ
                       ::**.*******. .**.** **********:    ** ***********

A0A8C1P2N8_BMF-01      LIGDQFYQEHMMDT--QWKKSWSLGAAVIHGRDGNVCMIKTRQNIGATPS
A0A8C1P2N8_BMF-02      LIGDQFYQEHMMSS--SNNR---LSGCS--QALMAINKIV--EPFVSTSC
A0A8C1P2N8_BMF-03      LIGDQFYQEHMMHH--RNQR---IREPLWWRVALAVYTLVFGREAEAREN
A0A8C1XUF5_BMF-01      LIGDQFYQEHMMHH--RNQR---IREPLWWRVALAVYTLVFGREAEAREN
A0A8C2DDJ7_BMF-01      LIGDQFYQEHMMKQACSQIR---CRVCLSCRSVWMVACLGAGRSCSQTNL
A0A8C1UAR1_BMF-01      LIGDQFYQEHMMSS--SNNR---LSDCS--QALMAINKIV--EPFVSTSC
A0A8C1UAR1_BMF-02      LIGDQFYQEHMMHH--RNQR---NREPLWWRVALAVYTLLFGREAEARAN
A0A8C2DDJ7_BMF-02      LIGDQFYQEHMMHH--RNQR---NREPLWWRVALAVYTLLFGREAEARAN
                       ************     . .               :  :           

A0A8C1P2N8_BMF-01      MRFMKV
A0A8C1P2N8_BMF-02      RS----
A0A8C1P2N8_BMF-03      RR----
A0A8C1XUF5_BMF-01      RR----
A0A8C2DDJ7_BMF-01      SSSN--
A0A8C1UAR1_BMF-01      RS----
A0A8C1UAR1_BMF-02      RR----
A0A8C2DDJ7_BMF-02      RR----
                             

© 1998-2022Legal notice