Dataset for protein Bmf of organism Cyprinus carpio

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A8C1P2N8_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Cyprinus carpio GN=BMF (length=140 residues).
MDEDEDDVHRKGLQHWPSSRVQLKQTETAGRAPVSPSVMLPCRVPTRLFYGSAGLLLLAPPSRSQPPDVVLRQNLRMMEP
AARPERSVETLIGQKLQLIGDQFYQEHMMSSSNNRLSGCSQALMAINKIVEPFVSTSCRS
>gnl|bcl2dbpro|A0A8C1P2N8_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Cyprinus carpio GN=BMF (length=144 residues).
MDEDEDDVHRKGLQHWPSSRVQLKQTETAGRAPVSPSVMLPCRVPTRLFYGSAGLLLLAPPSRSQPPDVVLRQNLRMMEP
AARPERSVETLIGQKLQLIGDQFYQEHMMHHRNQRIREPLWWRVALAVYTLVFGREAEARENRR
>gnl|bcl2dbpro|A0A8C1P2N8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Cyprinus carpio GN=BMF (length=151 residues).
MDEDEDDVHRKGLQHWPSSRVQLKQTETAGRAPVSPSVMLPCRVPTRLFYGSAGLLLLAPPSRSQPPDVVLRQNLRMMEP
AARPERSVETLIGQKLQLIGDQFYQEHMMDTQWKKSWSLGAAVIHGRDGNVCMIKTRQNIGATPSMRFMKV
>gnl|bcl2dbpro|A0A8C1UAR1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Cyprinus carpio GN=BMF (length=139 residues).
MDEDEDDVHRKGLQHWPSSQVQIKQTDTAGRAPVSPDSMLPCRVHVEPRRFLYGNAGLLLLASLGRSRPPHVVLRQNLRM
MDPEESVETLIGQKLQLIGDQFYQEHMMSSSNNRLSDCSQALMAINKIVEPFVSTSCRS
>gnl|bcl2dbpro|A0A8C1UAR1_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Cyprinus carpio GN=BMF (length=143 residues).
MDEDEDDVHRKGLQHWPSSQVQIKQTDTAGRAPVSPDSMLPCRVHVEPRRFLYGNAGLLLLASLGRSRPPHVVLRQNLRM
MDPEESVETLIGQKLQLIGDQFYQEHMMHHRNQRNREPLWWRVALAVYTLLFGREAEARANRR
>gnl|bcl2dbpro|A0A8C1XUF5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Cyprinus carpio GN=BMF (length=139 residues).
MNISTVXLQRWPSSHVQLKQTETAGRAPVSPSVMLPCRVPTRLFYGNAGLLLLAPPSRSQPPDVVLRQNLRMMEPAARPE
RSVETLIGQKLQLIGDQFYQEHMMHHRNQRIREPLWWRVALAVYTLVFGREAEARENRR
>gnl|bcl2dbpro|A0A8C2DDJ7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Cyprinus carpio GN=BMF (length=147 residues).
MDEDEDDVHRKGLQHWPSSQVQIKQTETAGRAPVSPNSMLPCRVHVEPRRFLYGNAGLLLLASLGRSRPPHVVLRQNLRM
MDPEESVETLIGQKLQLIGDQFYQEHMMKQACSQIRCRVCLSCRSVWMVACLGAGRSCSQTNLSSSN
>gnl|bcl2dbpro|A0A8C2DDJ7_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Cyprinus carpio GN=BMF (length=143 residues).
MDEDEDDVHRKGLQHWPSSQVQIKQTETAGRAPVSPNSMLPCRVHVEPRRFLYGNAGLLLLASLGRSRPPHVVLRQNLRM
MDPEESVETLIGQKLQLIGDQFYQEHMMHHRNQRNREPLWWRVALAVYTLLFGREAEARANRR
© 1998-2022Legal notice