Dataset for protein Bad of organism Ctenopharyngodon idella

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
* : :   :::*.: :..: .  ::* :* *  *.: * .:. . .    . ..  ::.           .   :.**.*
MdqtlsisqneSstsegrkts--eqTikNsGqpQgqtLrtvspsrrvrqysrsrvytvs-----------sdllngGAgD
 anmfhdhddd ealddkedphlde eh h lh dkq pnipdqlkgellgeqqnlsmnrwqdaepqdgaeaeeea  a 

        90       100       110       120       130       140       150       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
   ** **.***.*** ****************  **** :****        *   .*::**** **.:. .    
glpFRpRSrSAPpALWkAKKYGRQLRRMSDEFDtwLDKG-vKRVK--------QtyrsWlsFLWSpKEsegrs----
egd  g  q   a   a                il    em    sagtarqm qspg fa    h  edaeerpae
© 1998-2022Legal notice