Dataset for protein Bad of organism Ctenopharyngodon idella

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8F1NN26_BAD-01      MAQMFSISDNESETSEDREDP--DQTEHNSGLPQGKQLRTVPDSLKGEQL
A0A8F1NN29_BAD-01      MDNTLHDHQDDSSALDGKKTSHLEETIKNHGQHQDQTLPNISPQRRVRLY
                       * : :   :::*.: :..: .  ::* :* *  *.: * .:. . .    

A0A8F1NN26_BAD-01      GRQRNLSMN-----------EDLLEAGAADEGDFRPRSRSAPPALWAAKK
A0A8F1NN29_BAD-01      SESQVYTVSRWQDAEPQDGASAEENGGAGDGLPFRGRSQSAPAALWKAKK
                       . ..  ::.           .   :.**.*   ** **.***.*** ***

A0A8F1NN26_BAD-01      YGRQLRRMSDEFDILLDKG-MKRVKSAGTARQMQQSPSWLAFLWSHKESD
A0A8F1NN29_BAD-01      YGRQLRRMSDEFDTWLDKGEVKRVK--------QTYRGWFSFLWSPKEEE
                       *************  **** :****        *   .*::**** **.:

A0A8F1NN26_BAD-01      AESRPAE
A0A8F1NN29_BAD-01      GRE----
                       . .    

© 1998-2022Legal notice