Dataset for protein Bad of organism Ctenopharyngodon idella

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8F1NN26_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Ctenopharyngodon idella GN=BAD (length=143 residues).
MAQMFSISDNESETSEDREDPDQTEHNSGLPQGKQLRTVPDSLKGEQLGRQRNLSMNEDLLEAGAADEGDFRPRSRSAPP
ALWAAKKYGRQLRRMSDEFDILLDKGMKRVKSAGTARQMQQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|A0A8F1NN29_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Ctenopharyngodon idella GN=BAD (length=145 residues).
MDNTLHDHQDDSSALDGKKTSHLEETIKNHGQHQDQTLPNISPQRRVRLYSESQVYTVSRWQDAEPQDGASAEENGGAGD
GLPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGEVKRVKQTYRGWFSFLWSPKEEEGRE
© 1998-2022Legal notice