Dataset for protein Bim of organism Crocodylus porosus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                      .:* . **          ****..                  . *  ****. *.* *
--------------------rgwnGlgrGR----------LLLAgc-----------------qsvSprAGRArsGpAwL
rsgrsprrpgpaqtccaqhimend aaa  graapprrrp    aagagtartrrslalpvptpqc ga    qr a a 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:.  *: . *   *           **:     *: **.  .    *  **                        . *  
ssstSqhskFrrrP-----------GGl-----GseLLsyqvvlqnVmlFVr-----------------------srLtp
apfq kcng cae adsrsapvgta  fwsvek aa  gsffsclf ca  gsscgrcfasshfpdlilsdgacfge gd

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**:.  . .*..**..            *************************************************   
GAvwsqspgVvsLWsre-----------GKKDQMAKQPSDLNSKCGSEDRQLQPRERPSQPQPVRPGAPTSIQTQYQ---
  lrlgpld fg  kkasllamlslslq                                                 drs

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                ************************************************
--------------------------------ASRWQYRSIPEDMQPEIWIAQELRRIGDEFNASYCPRRGFWDNQGVNH
papmscdkstqtpsppcqafnhylsamgkqdh                                                

       330        
....:....|....:...
******************
QIILRLLHYIIRLIWRRQ
                  
© 1998-2021Legal notice