Dataset for protein Bim of organism Crocodylus porosus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A7M4F197_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Crocodylus porosus GN=BCL2L11 (length=303 residues).
RSGRSPRRPGPAQTCCAQHIRENNGLGRGRGRAAPPRRRPLLLAGCGAGTARTRRSLALPVPTQQVSGRAGRARSGAAWL
ASFTSKCNGFCRRPADSRSAPVGTAGGFWSVEKGSALLSYFFVCLFVCLFVRSSCGRCFASSHFPDLILSDGACFSELGD
GAVWLQSPDVVSLWSRESLLAMLSLSLQGKKDQMAKQPSDLNSKCGSEDRQLQPRERPSQPQPVRPGAPTSIQTQYQASR
WQYRSIPEDMQPEIWIAQELRRIGDEFNASYCPRRGFWDNQGVNHQIILRLLHYIIRLIWRRQ
>gnl|bcl2dbpro|A0A7M4F197_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Crocodylus porosus GN=BCL2L11 (length=241 residues).
MGWDGAAAGRLLLAAAPSCSPAAGRAQRGPAALSPSQSQHSKFRAEPGGLGAELLGSQVSLQNVMAFVGGRLTPGALRSG
PLGVFGLWKKAGKKDQMAKQPSDLNSKCGSEDRQLQPRERPSQPQPVRPGAPTSIQTQYQDRSPAPMSCDKSTQTPSPPC
QAFNHYLSAMGKQDHASRWQYRSIPEDMQPEIWIAQELRRIGDEFNASYCPRRGFWDNQGVNHQIILRLLHYIIRLIWRR
Q
© 1998-2021Legal notice