Dataset for protein Bim of organism Crocodylus porosus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7M4F197_BCL2L11      RSGRSPRRPGPAQTCCAQHIRENNGLGRGRGRAAPPRRRPLLLAGCGAGT
A0A7M4F197_BCL2L11      --------------------MGWDGAAAGR----------LLLAAA----
                                              .:* . **          ****..    

A0A7M4F197_BCL2L11      ARTRRSLALPVPTQQVSGRAGRARSGAAWLASFTSKCNGFCRRPADSRSA
A0A7M4F197_BCL2L11      -------------PSCSPAAGRAQRGPAALSPSQSQHSKFRAEP------
                                      . *  ****. *.* *:.  *: . *   *      

A0A7M4F197_BCL2L11      PVGTAGGFWSVEKGSALLSYFFVCLFVCLFVRSSCGRCFASSHFPDLILS
A0A7M4F197_BCL2L11      -----GGL-----GAELLGSQVSLQNVMAFVG------------------
                             **:     *: **.  .    *  **                   

A0A7M4F197_BCL2L11      DGACFSELGDGAVWLQSPDVVSLWSRESLLAMLSLSLQGKKDQMAKQPSD
A0A7M4F197_BCL2L11      -----GRLTPGALRSGPLGVFGLWKKA-----------GKKDQMAKQPSD
                             . *  **:.  . .*..**..            ************

A0A7M4F197_BCL2L11      LNSKCGSEDRQLQPRERPSQPQPVRPGAPTSIQTQYQ-------------
A0A7M4F197_BCL2L11      LNSKCGSEDRQLQPRERPSQPQPVRPGAPTSIQTQYQDRSPAPMSCDKST
                        *************************************             

A0A7M4F197_BCL2L11      ----------------------ASRWQYRSIPEDMQPEIWIAQELRRIGD
A0A7M4F197_BCL2L11      QTPSPPCQAFNHYLSAMGKQDHASRWQYRSIPEDMQPEIWIAQELRRIGD
                                              ****************************

A0A7M4F197_BCL2L11      EFNASYCPRRGFWDNQGVNHQIILRLLHYIIRLIWRRQ
A0A7M4F197_BCL2L11      EFNASYCPRRGFWDNQGVNHQIILRLLHYIIRLIWRRQ
                        **************************************

© 1998-2021Legal notice