Dataset for protein classical BH3-containing proteins of organism Coturnix japonica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
mdrpsyleedyssldgldddvfhsddfgla--------------------gqpgemtatgif-----------tqnqsys
------------p--------pp-e-----vrlrtglrcfypggerpaspmskh-f---s--fylvrrspllq------f
  makqpp akm-rrtrrkrl--g-pp r rpkep apaalc aafd    k  p-pis-sl ffi       rsssgf-
           a g riagpa  a ga p                      g  a afr p                   
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                         :                                                    . 
cllgrfqlfplthccgpgvrhpeqqdkatqtlspssssqdvmlpcgvteeprrlfygnagyrlhvppvgfaldpnlqeep
------sp-----------------elrrrrspr--------------------------------------grepvasr
sfeaer--v mpsi    e rr ee    ikpg            qc                 lshyls m-edagnqc
l       a   g                  k             aa                  ae    a  a a  a
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         :  :   :  :  .                                                         
qegqreartevqiarklqciadqfhrlhiqrhqq-----------nrnqvw--wqlflflhnlalnveanrnrtgqr---
svpldrivpqawvrqvisrlqtssn---cpvt--gvltytrkils------lt------------------------smt
aihpakeqekigl ae rn iaklmhsy mkskh           hktclyfsyyyepliyhrsqrqsvlpisstsiese
 ae    gd  d      e facg   r                  i   fi c   ac  kgks ie gn  ilp
                               d                                              g 

       250       260       270       280       290   
....:....|....:....|....:....|....:....|....:....|...
                                                     
---h-------------------------------------------------
swg-slsssllsasllshhlhhsassghccslatqrcslgaempsaascglam
glwttpqkaiitd    apvfirllw etgvtqr  gkihp            
eys q ee                                             
d n                                                  
© 1998-2022Legal notice