Dataset for protein classical BH3-containing proteins of organism Coturnix japonica

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2TYI5_BCL2L11      --------------------------------------------------
A0A8C2TYD3_BMF-03       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLA--------------------
A0A8C2TYD3_BMF-04       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLA--------------------
A0A8C2TYD3_BMF-02       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLA--------------------
A0A8C2TYD3_BMF-01       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLA--------------------
A0A8C2TYD3_BMF-05       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLA--------------------
A0A8C2T4E6_PMAIP1-      -----------MPGRTIRKPAPPAEPAGRARRKETGLRCFYCGGEFDA--
A0A8C2TW35_BCL2L11      --MAKQPPEAKAPRDRRAGRLPPGEGPGPAVPLRPGAPAALPGAARPASP
                                                                          

A0A8C2TYI5_BCL2L11      MGPG-------------------------------------------GER
A0A8C2TYD3_BMF-03       GQPGEMTATGIF-----------TQNQSYSCLLGRFQLFPLTHCCGPGVR
A0A8C2TYD3_BMF-04       GQPGEMTATGIF-----------TQNQSYSCLLGRFQLFPLTHCCGPGVR
A0A8C2TYD3_BMF-02       GQPGEMTATGIF-----------TQNQSYSCLLGRFQLFPLTHCCGPGVR
A0A8C2TYD3_BMF-01       GQPGEMTATGIF-----------TQNQSYSCLLGRFQLFPLTHCCGPGVR
A0A8C2TYD3_BMF-05       GQPGEMTATGIF-----------TQNQSYSCLLGRFQLFPLTHCCGPGVR
A0A8C2T4E6_PMAIP1-      GKKHAFPFSSSFFYLI------------FFLL----SPVPLPGI------
A0A8C2TW35_BCL2L11      GSPGPFAIRSPLFFFVRRSPLLQRSSSGYFSFEAERSPAPM-SC------
                                                                          

A0A8C2TYI5_BCL2L11      RREEEEKRRRRKGR------------------------------------
A0A8C2TYD3_BMF-03       HPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGF
A0A8C2TYD3_BMF-04       HPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGF
A0A8C2TYD3_BMF-02       HPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGF
A0A8C2TYD3_BMF-01       HPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGF
A0A8C2TYD3_BMF-05       HPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGF
A0A8C2T4E6_PMAIP1-      -----DLARIKSPP---------PCAC-----------------LAE---
A0A8C2TW35_BCL2L11      -----DKATQTPSP---------PCQA-----------------VSHYLS
                             :                                            

A0A8C2TYI5_BCL2L11      -AGPAPAAQRSAPPAEIQPEIWIAQELRRIGDEFNASYCPRR--------
A0A8C2TYD3_BMF-03       ALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQRDKHGVLTYT
A0A8C2TYD3_BMF-04       ALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQRHQQ------
A0A8C2TYD3_BMF-02       ALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQRHQQ------
A0A8C2TYD3_BMF-01       ALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQRHQQ------
A0A8C2TYD3_BMF-05       ALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQRHQQ------
A0A8C2T4E6_PMAIP1-      ---RDAVAECAVELRRIGDKADLRQKILNLITKLF---CPKT--------
A0A8C2TW35_BCL2L11      AMGEELGNSASIHLDKEVEQAGVAAVLSCLQASSMHCGCMVS--------
                                .          :  :   :  :  .                 

A0A8C2TYI5_BCL2L11      ---------VIFSYFYFPFLYARSLKGKSLIISGN---------------
A0A8C2TYD3_BMF-03       RKILSHKTCLYLTWYIECLIHHCAQRQSVLPERSTSISGTGLNH------
A0A8C2TYD3_BMF-04       -----NRNQVW--WQLFLFLHNLALNVEANRNRTGQRISTEYSHTPEKS-
A0A8C2TYD3_BMF-02       -----NRNQVW--WQLFLFLHNLALNVEANRNRTGQREMESWGHSLSSAL
A0A8C2TYD3_BMF-01       -----NRNQVW--WQLFLFLHNLALNVEANRNRTGQREMESWGHSLSSAL
A0A8C2TYD3_BMF-05       -----NRNQVW--WQLFLFLHNLALNVEANRNRTGQRSLPDLWTQLQESI
A0A8C2T4E6_PMAIP1-      --------------------------------------------------
A0A8C2TW35_BCL2L11      --------------------------------------------------
                                                                          

A0A8C2TYI5_BCL2L11      -------------------------------------------
A0A8C2TYD3_BMF-03       -------------------------------------------
A0A8C2TYD3_BMF-04       -------------------------------------------
A0A8C2TYD3_BMF-02       LSASLLSHHLHHSASSGHCCSLATQRCSLGAEMPSAASCGLAM
A0A8C2TYD3_BMF-01       LSASLLSHHLHHSASSGHCCSLATQRCSLGAEMPSAASCGLAM
A0A8C2TYD3_BMF-05       ITDS--SAPVFIRLLWGETGVTQRQRGKIHP------------
A0A8C2T4E6_PMAIP1-      -------------------------------------------
A0A8C2TW35_BCL2L11      -------------------------------------------
                                                                   

© 1998-2022Legal notice