Dataset for protein classical BH3-containing proteins of organism Coturnix japonica

[Download (right click)] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8C2TW35_BCL2L11-01      M----------------------------AKQPPEAKAPRDRRAGRLPPG
A0A8C2T4E6_PMAIP1-01       MPGRTIRKP---------------------APP-----------------
A0A8C2TYD3_BMF-01          MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTAT-----------
A0A8C2TYD3_BMF-05          MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTAT-----------
A0A8C2TYD3_BMF-03          MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTAT-----------
A0A8C2TYD3_BMF-04          MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTAT-----------
A0A8C2TYI5_BCL2L11-01      --------------------------------------------------
A0A8C2TYD3_BMF-02          MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTAT-----------
                                                                             

A0A8C2TW35_BCL2L11-01      EGPGPAVPLRPGAPAALPGAARPASPGSPGPFAIRSPLFFFVRR---SPL
A0A8C2T4E6_PMAIP1-01       --------------------------------------------------
A0A8C2TYD3_BMF-01          -----------------------------GIFTQNQSYSCLLGRFQLFPL
A0A8C2TYD3_BMF-05          -----------------------------GIFTQNQSYSCLLGRFQLFPL
A0A8C2TYD3_BMF-03          -----------------------------GIFTQNQSYSCLLGRFQLFPL
A0A8C2TYD3_BMF-04          -----------------------------GIFTQNQSYSCLLGRFQLFPL
A0A8C2TYI5_BCL2L11-01      --------------------------------------------------
A0A8C2TYD3_BMF-02          -----------------------------GIFTQNQSYSCLLGRFQLFPL
                                                                             

A0A8C2TW35_BCL2L11-01      LQRSSSGYFSFEAERS-PAPMS-----------CDKATQTPSPPCQAVSH
A0A8C2T4E6_PMAIP1-01       ---AEPA--------GRARRKETGLRCFYCGGEFDAGKKHAFPFSSSF--
A0A8C2TYD3_BMF-01          THCCGPG--------V-RHPEQ-----------QDKATQTLSPSSSSQDV
A0A8C2TYD3_BMF-05          THCCGPG--------V-RHPEQ-----------QDKATQTLSPSSSSQDV
A0A8C2TYD3_BMF-03          THCCGPG--------V-RHPEQ-----------QDKATQTLSPSSSSQDV
A0A8C2TYD3_BMF-04          THCCGPG--------V-RHPEQ-----------QDKATQTLSPSSSSQDV
A0A8C2TYI5_BCL2L11-01      ---MGPG--------GERRREE----------------------------
A0A8C2TYD3_BMF-02          THCCGPG--------V-RHPEQ-----------QDKATQTLSPSSSSQDV
                                ..              .                            

A0A8C2TW35_BCL2L11-01      YLSA-MGEE-----------------LGNSASIHLDKEVEQA--------
A0A8C2T4E6_PMAIP1-01       -------------FYLIFFLLSPVPLPGIDLARIKSPPPCACLAERDAVA
A0A8C2TYD3_BMF-01          MLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEV
A0A8C2TYD3_BMF-05          MLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEV
A0A8C2TYD3_BMF-03          MLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEV
A0A8C2TYD3_BMF-04          MLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEV
A0A8C2TYI5_BCL2L11-01      -------EEKRRRRKGRAGPA-------------PAAQRSAPPAEIQPEI
A0A8C2TYD3_BMF-02          MLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEV
                                                                             

A0A8C2TW35_BCL2L11-01      GVAAVLSCLQ----------------------------------------
A0A8C2T4E6_PMAIP1-01       ECAVELRRIGDKADLR------QKILNLITKLF-----------------
A0A8C2TYD3_BMF-01          QIARKLQCIADQFHRLHIQRHQQNRN-------------QVWWQLFLFLH
A0A8C2TYD3_BMF-05          QIARKLQCIADQFHRLHIQRHQQNRN-------------QVWWQLFLFLH
A0A8C2TYD3_BMF-03          QIARKLQCIADQFHRLHIQRDKHGVLTYTRKILSHKTCLYLTWYIECLIH
A0A8C2TYD3_BMF-04          QIARKLQCIADQFHRLHIQRHQQNRN-------------QVWWQLFLFLH
A0A8C2TYI5_BCL2L11-01      WIAQELRRIGDEFNASYCPRRVI-----------------FSYFYFPFLY
A0A8C2TYD3_BMF-02          QIARKLQCIADQFHRLHIQRHQQNRN-------------QVWWQLFLFLH
                             *  *  :                                         

A0A8C2TW35_BCL2L11-01      ------------------------------------------ASS-----
A0A8C2T4E6_PMAIP1-01       --------------------------------------------------
A0A8C2TYD3_BMF-01          NLALNVEANRNRTGQREMESWGHSLSSALLSASLLSHHLHHSASSGHCCS
A0A8C2TYD3_BMF-05          NLALNVEANRNRTGQRSLPDLWTQLQESIITDSSAPVFI-----------
A0A8C2TYD3_BMF-03          HCAQR-----QSVLPERSTS------------------------------
A0A8C2TYD3_BMF-04          NLALNVEANRNRTGQRISTEYSH---------------------------
A0A8C2TYI5_BCL2L11-01      ARSLK----------GKSL-------------------------------
A0A8C2TYD3_BMF-02          NLALNVEANRNRTGQREMESWGHSLSSALLSASLLSHHLHHSASSGHCCS
                                                                             

A0A8C2TW35_BCL2L11-01      ---------------MHCGCMVS
A0A8C2T4E6_PMAIP1-01       -------------------CPKT
A0A8C2TYD3_BMF-01          LATQRCSLGAEMPS-AASCGLAM
A0A8C2TYD3_BMF-05          ----RLLWGETGVTQRQRGKIHP
A0A8C2TYD3_BMF-03          ---------------ISGTGLNH
A0A8C2TYD3_BMF-04          ------------------TPEKS
A0A8C2TYI5_BCL2L11-01      ------------------IISGN
A0A8C2TYD3_BMF-02          LATQRCSLGAEMPS-AASCGLAM
                                                  

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice