Dataset for protein classical BH3-containing proteins of organism Coturnix japonica

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A8C2T4E6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Coturnix japonica GN=PMAIP1 (length=117 residues).
MPGRTIRKPAPPAEPAGRARRKETGLRCFYCGGEFDAGKKHAFPFSSSFFYLIFFLLSPVPLPGIDLARIKSPPPCACLA
ERDAVAECAVELRRIGDKADLRQKILNLITKLFCPKT
>gnl|bcl2dbpro|A0A8C2TW35_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Coturnix japonica GN=BCL2L11 (length=152 residues).
MAKQPPEAKAPRDRRAGRLPPGEGPGPAVPLRPGAPAALPGAARPASPGSPGPFAIRSPLFFFVRRSPLLQRSSSGYFSF
EAERSPAPMSCDKATQTPSPPCQAVSHYLSAMGEELGNSASIHLDKEVEQAGVAAVLSCLQASSMHCGCMVS
>gnl|bcl2dbpro|A0A8C2TYD3_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Coturnix japonica GN=BMF (length=249 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNVEANRNRTGQREMESWGHSLSSALLSASLLSHHLHHSASSGHCCSLATQRCSLGAEMP
SAASCGLAM
>gnl|bcl2dbpro|A0A8C2TYD3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Coturnix japonica GN=BMF (length=249 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNVEANRNRTGQREMESWGHSLSSALLSASLLSHHLHHSASSGHCCSLATQRCSLGAEMP
SAASCGLAM
>gnl|bcl2dbpro|A0A8C2TYD3_BMF-05 Bcl2 modifying factor protein OS=[Eukaryota] Coturnix japonica GN=BMF (length=235 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNVEANRNRTGQRSLPDLWTQLQESIITDSSAPVFIRLLWGETGVTQRQRGKIHP
>gnl|bcl2dbpro|A0A8C2TYD3_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Coturnix japonica GN=BMF (length=213 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQR
DKHGVLTYTRKILSHKTCLYLTWYIECLIHHCAQRQSVLPERSTSISGTGLNH
>gnl|bcl2dbpro|A0A8C2TYD3_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Coturnix japonica GN=BMF (length=205 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNVEANRNRTGQRISTEYSHTPEKS
>gnl|bcl2dbpro|A0A8C2TYI5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Coturnix japonica GN=BCL2L11 (length=88 residues).
MGPGGERRREEEEKRRRRKGRAGPAPAAQRSAPPAEIQPEIWIAQELRRIGDEFNASYCPRRVIFSYFYFPFLYARSLKG
KSLIISGN
© 1998-2022Legal notice