Dataset for protein classical BH3-containing proteins of organism Coregonus sp balchen

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                              .  . .   .     .   .  .           
-----------------------------------------mitysdrgtqpsspvletpndqvpcgvgqtprpl-----
mqgmprpqlslqvladrrrmddeeddvfvpdsshcwrtafrefkiestrsetpe-agaletsmsaaqqamegg--fygna
   hflihidkkd   fc          e   f     maq----m skpr ggr rlysk klcs k k---       
                                               ce     d     e                   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                    . .  .        *   *  .*.  **       * :*. :.*
ghrltfp------------------------arfeevqdqgpgvdgqgtdGasfRvrsQsapPAlwaakkyGrqLrrmsD
-f--h--emrlagegrlrlnsesqafstsrg----rlggvmt----vper rme lqq pqq  rsmevyi qk qlig 
 -t -vq                        rqntqf   qtrhi g  gp  ge       q i  r  c       
  a  a                         kedg     peeeg                      c          

       170       180       190       200       210       220
....:....|....:....|....:....|....:....|....:....|....:....|
:*         .   .    :*      *        : *:. :                
eFdtwldkgemqrhlslghrkQrtmrpsWw-------tyLfsqqetegrhr---------
q --------pkqvkqvyaan mnssgl rrlasallal weheavateg-stwtprssr
          lreli p gc  kvq  - f       sf   pk i  getpnlrapepe
          h  g  a       k                    a    sagip     
© 1998-2020Legal notice