Dataset for protein classical BH3-containing proteins of organism Coregonus sp balchen

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A6F9B4C5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Coregonus sp. 'balchen' GN=BMF (length=175 residues).
MFRIHIDLKVLADRRRMDDEEDDVFEPDFHCWRTAFREIKYEDRGTQTPSPVLALPNSMVPCGVAQEPRPLFYGNAGFRL
HFPAQFERVGDQGPQGERGGMERLEQQPQQPARSIEVYIGQKLQLIGDQFLQQHLQLYHRNQRNMRPLWRRLASALLTLL
FEQEAVAGGGRAGWR
>gnl|bcl2dbpro|A0A6F9BAV3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Coregonus sp. 'balchen' GN=BAD (length=116 residues).
MSTRPRPGGRVRLYSESQVCSQVGKREDTEFQDVMTPTEEGGGDGASFRGRSQSAPPALWAAKKYGCQLRRMSDEFDTWL
DKGEPKRGISPGGCKQKVSRGWFSFLWSPKEAEGRE
>gnl|bcl2dbpro|A0A6F9BGV6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Coregonus sp. 'balchen' GN=BMF (length=179 residues).
MQGHPLPQLSKQDLADFCRMDDEEDDVFVPDSSHCWRTAFREIKYEDRGTQTPSPALALPNDMLPCGVAQEPRPLFYGNA
GFRLHFPARFEQVGDQGPQERHQGERGRMERLQQQPQQPAQSMEVCIGQKLQLIGDQFHQEHLQLYHRNQRNMRPLWWRL
ASALLTLLFEQEAIAGRGR
>gnl|bcl2dbpro|A0A6F9CA11_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Coregonus sp. 'balchen' GN=BAD (length=142 residues).
MAQMFTISDSESEPSEDVGETETDQSAAGKGMTGGPLGHALTAQELQGSGPGVDGVPTDGASFRVRSQSAPPALWAAKKY
GRQLRRMSDEFDTWLDKGEMRRVKSAGAAKQMTKSPSWWAYLFSHQETETEHTSTIPPRSSE
>gnl|bcl2dbpro|A0A6F9CQZ0_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Coregonus sp. 'balchen' GN=BAD (length=166 residues).
MFTISDCKSEPSEVGETEKDKSAAGQGMTGGPLGHTLTVPEMRLAGEGRLRLNSESQAFSTSRGKRNGELQGRGPGVDGI
PTDGAPFRVRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGEMKQLKSVGAAKQMTQSPSWWAYLFSHQETETEHSPNL
TAPEPR
© 1998-2020Legal notice