Dataset for protein classical BH3-containing proteins of organism Coregonus sp balchen

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A6F9BAV3_BAD-01      ---------------------------------------------MSTRP
A0A6F9B4C5_BMF-01      ---MFRIHIDLKVLADRRRMDDEEDDVFEPD-FHCWRTAFREIKYEDRGT
A0A6F9BGV6_BMF-01      MQGHPLPQLSKQDLADFCRMDDEEDDVFVPDSSHCWRTAFREIKYEDRGT
A0A6F9CA11_BAD-02      --------------------------------------MAQMFTISDSES
A0A6F9CQZ0_BAD-02      -----------------------------------------MFTISDCKS
                                                                     .  .

A0A6F9BAV3_BAD-01      RPGGRVRLYSESQVCSQVGK------------------------------
A0A6F9B4C5_BMF-01      QTPSPVLALPNSMVPCGVAQEPRPLFYGNAGFRLHFP-------------
A0A6F9BGV6_BMF-01      QTPSPALALPNDMLPCGVAQEPRPLFYGNAGFRLHFP-------------
A0A6F9CA11_BAD-02      EPSEDVGETETDQSAAGKGMTGGPL-----GHALTAQ-------------
A0A6F9CQZ0_BAD-02      EPSE-VGETEKDKSAAGQGMTGGPL-----GHTLTVPEMRLAGEGRLRLN
                        .   .     .   .  .                               

A0A6F9BAV3_BAD-01      -----------REDTEFQDVMTPTEEGGGDGASFRGRSQSAPPALWAAKK
A0A6F9B4C5_BMF-01      -----------AQFERVGDQGP----QGERGGMERLEQQPQQPARSIEVY
A0A6F9BGV6_BMF-01      -----------ARFEQVGDQGPQERHQGERGRMERLQQQPQQPAQSMEVC
A0A6F9CA11_BAD-02      ---------------ELQGSGPGVDGVPTDGASFRVRSQSAPPALWAAKK
A0A6F9CQZ0_BAD-02      SESQAFSTSRGKRNGELQGRGPGVDGIPTDGAPFRVRSQSAPPALWAAKR
                                       . .  .        *   *  .*.  **      

A0A6F9BAV3_BAD-01      YGCQLRRMSDEFDTWLDKGEPKRGISPGGCKQKVSRG-WF-------SFL
A0A6F9B4C5_BMF-01      IGQKLQLIGDQF--------LQQHLQLYHRNQRNMRPLWRRLASALLTLL
A0A6F9BGV6_BMF-01      IGQKLQLIGDQF--------HQEHLQLYHRNQRNMRPLWWRLASALLTLL
A0A6F9CA11_BAD-02      YGRQLRRMSDEFDTWLDKGEMRRVKSAGAAKQMTKSPSWW-------AYL
A0A6F9CQZ0_BAD-02      YGRQLRRMSDEFDTWLDKGEMKQLKSVGAAKQMTQSPSWW-------AYL
                        * :*. :.*:*         .   .    :*      *        : *

A0A6F9BAV3_BAD-01      WSPKEAEGRE----------
A0A6F9B4C5_BMF-01      FEQEAVAGGGRAGWR-----
A0A6F9BGV6_BMF-01      FEQEAIAGRGR---------
A0A6F9CA11_BAD-02      FSHQETETEHTSTIPPRSSE
A0A6F9CQZ0_BAD-02      FSHQETETEHSPNLTAPEPR
                       :. :                

© 1998-2020Legal notice