Dataset for protein Bim of organism Colobus angolensis palliatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
                                                                                

        90       100       110       120       130     
....:....|....:....|....:....|....:....|....:....|....:
***************************************************. ::
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMgvwe
                                                   anfd
© 1998-2020Legal notice