Dataset for protein Bim of organism Colobus angolensis palliatus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K5HZI5_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|A0A2K5HZI5_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGVFE
© 1998-2020Legal notice