Dataset for protein Bim of organism Colobus angolensis palliatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5HZI5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K5HZI5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
                        **************************************************

A0A2K5HZI5_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2K5HZI5_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
                        **************************************************

A0A2K5HZI5_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
A0A2K5HZI5_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGVFE
                        *******************************. ::

© 1998-2020Legal notice