Dataset for protein classical BH3-containing proteins of organism Chrysemys picta bellii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------p------y--------d---------g------
mssyffagkkdqmakqssdlnsecnreggqfqsierpsqpqhlrpgp-tylqtq-ssnhsleg-vfqspfglt-ssspst
                                            mda ssieed qgldggdd fahqd   s qpgems
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                             .       . :    .                   
p-g-f----s-s----rsplfplvrcssplsrhas-----qtdrspqtmspssstqtpspp---c-------------ag
-q-p-tqps-y-pllt-fq--ifthrcglgi-ssegyfsfdq-katapllcdkgqesvmlaesq-gvteepqrlfygnqa
 p i apnq p cfagm-- t---------- ---slsm --q-m gkvfrkrak d l     r h sgskqpdtpt--
                 h    pfs  aapg   p     ri ef det  gg     a                    e

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                . :. :     :*. :.*                              
yrlyvspvgkqlnpsrqeep----rv-rrearpevwia----reLrrigDefnrsy----ipr-----nqqvrnqvwwri
fnhhlpam-fadhahlw-s-ggafsegqedmqtviqcsmrygqk qcma qchalhqvlpcq-rgfldhpannh-iilql
--------p--------d-     --r--sqpaim a     sq  k s i dvqq    --ksagtt------n---kt
v srigsd ps e ev         a s a e  l                  lal    r       s lh g s ke 

       250       260 
....:....|....:....|.
*     *              
LryiirLiwrvq---------
 lflhn alnleanrnhvgqr
 qvw-- ghpptrdapprssk
 na tk fc ga         
© 1998-2022Legal notice