Dataset for protein classical BH3-containing proteins of organism Chrysemys picta bellii

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A8C3FX85_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Chrysemys picta bellii GN=BCL2L11 (length=208 residues).
MAKQSSDLNSECNREGGQFQSIERPSQPQHLRPGAPTSIQTQYQGNHSGEGDFAQQPSGSSSPSSPQGPFAPPSSPSPFA
TRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGKQDHASRWESPSVREDMQPEIW
IAQELRRIGDEFNASYCPRRGFLDNPAVNHQIILRLLRYIIRLIWRLQ
>gnl|bcl2dbpro|A0A8C3FX85_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Chrysemys picta bellii GN=BCL2L11 (length=220 residues).
MSSYFFAGKKDQMAKQSSDLNSECNREGGQFQSIERPSQPQHLRPGAPTSIQTQYQGNHSGEGDFAQQPSGSSSPSSPQG
PFAPPSSPSPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGKQDHASRWES
PSVREDMQPEIWIAQELRRIGDEFNASYCPRRGFLDNPAVNHQIILRLLRYIIRLIWRLQ
>gnl|bcl2dbpro|A0A8C3IH53_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Chrysemys picta bellii GN=BAD (length=163 residues).
MHPLTPPFSCSAAPGRHAPSLSMFRIQEFPDEVFPGRGKESPLPPESQRGHTSGSKQPDTPTAEVRSRIGSDPPSLEPEV
QDEPGGAFRARSRSAPPILWAAMRYGRELRRMSDEFDVALQVLPRPKSAGTTSQLHRGNSWKETLQAWLGHRPARDAPPR
SSK
>gnl|bcl2dbpro|A0A8C3ILG9_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Chrysemys picta bellii GN=PMAIP1 (length=54 residues).
MPGKTLRKGAQQSPAPAAQEAVMQCSSQLRKIGDICNLQQKILNVITKLFCPGT
>gnl|bcl2dbpro|A0A8C3P5Z9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Chrysemys picta bellii GN=BMF (length=192 residues).
MDPPSYLEEDYSSLDGLDDDVFHSDFGLTGQPGEMTPPGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHAEQQDKATQTL
SPSSSTQDVMLPCGVTEEPQRLFYGNAGYRLHVPPVGFALNPHLQEEPREGQREARTEVQIARKLQCIADQFHRLHIQRH
QQNRNQVWWQILLFLHNLALNVEANRNHVGQR
>gnl|bcl2dbpro|A0A8C3P5Z9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Chrysemys picta bellii GN=BMF (length=192 residues).
MDPPSYLEEDYSSLDGLDDDVFHSDFGLTGQPGEMTPPGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHAEQQDKATQTL
SPSSSTQDVMLPCGVTEEPQRLFYGNAGYRLHVPPVGFALNPHLQEEPREGQREARTEVQIARKLQCIADQFHRLHIQRH
QQNRNQVWWQILLFLHNLALNVEANRNHVGQR
© 1998-2022Legal notice