Dataset for protein classical BH3-containing proteins of organism Chrysemys picta bellii

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3ILG9_PMAIP1-      --------------------------------------------------
A0A8C3IH53_BAD-01       ----------MHPLTPPFSCSAAPGRHAPSLSMFRIQEFPDEVFPGRGKE
A0A8C3FX85_BCL2L11      MSSYFFAGKKDQMAKQSSDLNSECNREGGQFQSIERPSQPQHLRP--GAP
A0A8C3FX85_BCL2L11      ------------MAKQSSDLNSECNREGGQFQSIERPSQPQHLRP--GAP
                                                                          

A0A8C3ILG9_PMAIP1-      ------------------------------------------MPGKTLRK
A0A8C3IH53_BAD-01       SPLPPESQRGHTSGSKQPDTPTAEVRSRIGSDPPSLEPEVQDEPGGAFRA
A0A8C3FX85_BCL2L11      TSIQTQYQGNHSGEGDFAQQPS-------GSSSPS-------SPQGPFAP
A0A8C3FX85_BCL2L11      TSIQTQYQGNHSGEGDFAQQPS-------GSSSPS-------SPQGPFAP
                                                                   *  .:  

A0A8C3ILG9_PMAIP1-      GAQQSP---------------------------------APAAQEAVMQC
A0A8C3IH53_BAD-01       RSRSAP-----PILWAAMRYGRELRRMSDEFDVALQVLPRPKSAGTTSQL
A0A8C3FX85_BCL2L11      PSSPSPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A8C3FX85_BCL2L11      PSSPSPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT
                         :  :*                                  * :     * 

A0A8C3ILG9_PMAIP1-      ---------------------------------------SSQLRKIGDIC
A0A8C3IH53_BAD-01       ------------------HRGNSWKE-------TLQAWLGHRPAR-----
A0A8C3FX85_BCL2L11      PSPPCQAFNHYLSAMGKQDHASRWESPSVREDMQPEIWIAQELRRIGDEF
A0A8C3FX85_BCL2L11      PSPPCQAFNHYLSAMGKQDHASRWESPSVREDMQPEIWIAQELRRIGDEF
                                                               .    .     

A0A8C3ILG9_PMAIP1-      N------------------LQQKILNVITKLFCPGT
A0A8C3IH53_BAD-01       -----------DAPPRSSK-----------------
A0A8C3FX85_BCL2L11      NASYCPRRGFLDNPAVNHQIILRLLRYIIRLIWRLQ
A0A8C3FX85_BCL2L11      NASYCPRRGFLDNPAVNHQIILRLLRYIIRLIWRLQ
                                                            

© 1998-2023Legal notice