Dataset for protein classical BH3-containing proteins of organism Chrysemys picta bellii

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3ILG9_PMAIP1-      --------------------------------------------------
A0A8C3IH53_BAD-01       --------------------------------------------------
A0A8C3P5Z9_BMF-01       --------------------------------------------MDPPSY
A0A8C3P5Z9_BMF-02       --------------------------------------------MDPPSY
A0A8C3FX85_BCL2L11      ------------MAKQSSDLNSECNREGGQFQSIERPSQPQHLRPGAPTS
A0A8C3FX85_BCL2L11      MSSYFFAGKKDQMAKQSSDLNSECNREGGQFQSIERPSQPQHLRPGAPTS
                                                                          

A0A8C3ILG9_PMAIP1-      --------------------------------------------------
A0A8C3IH53_BAD-01       ----------------------------------------------MHPL
A0A8C3P5Z9_BMF-01       LEEDYSSLDGLDDDVFHSDFGLTGQPGEMTPPGIFTQNQSYSCLLGRFQL
A0A8C3P5Z9_BMF-02       LEEDYSSLDGLDDDVFHSDFGLTGQPGEMTPPGIFTQNQSYSCLLGRFQL
A0A8C3FX85_BCL2L11      IQTQYQGNHSGEGDFAQQP---SGSSSPSSPQGPFAPPSSPSPFATRSPL
A0A8C3FX85_BCL2L11      IQTQYQGNHSGEGDFAQQP---SGSSSPSSPQGPFAPPSSPSPFATRSPL
                                                                          

A0A8C3ILG9_PMAIP1-      ------------------------MPGKTLRKGAQQSPAPA---------
A0A8C3IH53_BAD-01       TPPFSCSAAPGRHAPSLSMFRIQEFPDEVFPGRGKESPLPPESQRGHTSG
A0A8C3P5Z9_BMF-01       FPLTHCCGPGIRHAE-----QQDKATQTLSPSSSTQDVMLP---CGVTEE
A0A8C3P5Z9_BMF-02       FPLTHCCGPGIRHAE-----QQDKATQTLSPSSSTQDVMLP---CGVTEE
A0A8C3FX85_BCL2L11      FIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPP---C-----
A0A8C3FX85_BCL2L11      FIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPP---C-----
                                                 .       . :    .         

A0A8C3ILG9_PMAIP1-      ---------------------------------------AQEAVMQCS--
A0A8C3IH53_BAD-01       SKQPDTPTAEVRSRIGSDPPSLEPEVQDEPGGAFRARSRSAPPILWAAMR
A0A8C3P5Z9_BMF-01       PQRLFYGNAGYRLHVPPVGFALNPHLQEEP----REGQREARTEVQIA--
A0A8C3P5Z9_BMF-02       PQRLFYGNAGYRLHVPPVGFALNPHLQEEP----REGQREARTEVQIA--
A0A8C3FX85_BCL2L11      --------QAFNHYLSAMGKQDHASRWESP----SV-REDMQPEIWIA--
A0A8C3FX85_BCL2L11      --------QAFNHYLSAMGKQDHASRWESP----SV-REDMQPEIWIA--
                                                                  . :. :  

A0A8C3ILG9_PMAIP1-      --SQLRKIGDICNLQQ----------------------KILNVITKLFCP
A0A8C3IH53_BAD-01       YGRELRRMSDEFDVALQVLPRPKSAGTTSQLHRGNSWKETLQAW--LGHR
A0A8C3P5Z9_BMF-01       --RKLQCIADQFHRLH----IQR-----HQQNRNQVWWQILLFLHNLALN
A0A8C3P5Z9_BMF-02       --RKLQCIADQFHRLH----IQR-----HQQNRNQVWWQILLFLHNLALN
A0A8C3FX85_BCL2L11      --QELRRIGDEFNASY----CPRRGFLDNPAVNHQIILRLLRYIIRLIWR
A0A8C3FX85_BCL2L11      --QELRRIGDEFNASY----CPRRGFLDNPAVNHQIILRLLRYIIRLIWR
                           :*. :.*                              *     *   

A0A8C3ILG9_PMAIP1-      GT---------
A0A8C3IH53_BAD-01       PARDAPPRSSK
A0A8C3P5Z9_BMF-01       VEANRNHVGQR
A0A8C3P5Z9_BMF-02       VEANRNHVGQR
A0A8C3FX85_BCL2L11      LQ---------
A0A8C3FX85_BCL2L11      LQ---------
                                   

© 1998-2022Legal notice