Dataset for protein classical BH3-containing proteins of organism Chinchilla lanigera

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
trpgrrrsrqgtrrgqprlylsqparagsprgagaglalpraeaglggggargdwtrarsrqselgcraaqvslrsaqpp
                                                                              ml
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------------------------ps----ss-epp-ma
ragvfwkqyravsprqlrsrprrvtvparlgpspsphrvwvpspvvsgtrrpgappwpfqipele--eqld--t---qlt
g elaga rpmprapphhrsqpprpprtpelfrllqthrrslrlssqvrlel llqsmwytqaftlpwyeckpspergsg
           ac glega  eilemlladk pcf lgllq qkrrlrlhd   eaahttsecdsmilsvrgerkkdncv
                         g   a  h a   aea  apec ic    a   hdp   l agkhpaama  a  
                                                                   ae           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
kqpsd-----------------------vssecdteggqlq----paerppqlrpggltslqtepqrhssyp--------
pgltgdvfqpedgepgtqpgsllsadlfdrlgsn-plrr-gdtshqqrqlrgsshhagegamdtrsdr-pa-tgmekstg
ra ge                       pqw---cah fi-lfpltrsnglspattsqatpasqtl--l--smscdeeeq
ee e                        laaqlaaq  - h    dklca  c  eipqpklemagspars q vmlpc 
a  a                        a                 hc       d   d   a eqk ep         
                                                                  k   k         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                       .        ..              . ::* :.*.:                     
-psep------------------asmrqsqaappdl------rpeiwiarelRrigDefnasypr---lnhyqaaedqpq
v-e--sqafngnagyrlhylsampfrgrltseaanvrgqwqqwaavrygqqf cms qlvd----rvf-----------k
te-p crl y       plpasfsaqltprqq  eg  eeeh-- qec a   a k h-rfkg   rprpksqgtat-
mt a q                  lg p eg   g          rq          d  fq e     rqeeq rhr s
     e                   a g  e                                                r
                                                                                

       330       340       350        
....:....|....:....|....:....|....:...
           .                          
mwilrllryivrlwwrmh--------------------
lv-ssnwtraiqvvydvnlgllplprggsapsqgvnpr
--qq-------kslsqrtmf hn glnhgenrmepg  
phm-qrqqnqs  f nll          e  ee     
    k mnl n    l i                    
                                      
© 1998-2022Legal notice