Dataset for protein classical BH3-containing proteins of organism Chinchilla lanigera

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
trprrrvswqqyrrvqprlyrsrpprrpsprglgfpllpprveaglggggargdwtrarsrqselgcraaqvslrsaqpl
 m gagrfrkgt agc g llaq a agp aaa ag alh a                                      
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------------------------ps----ss-epp-ma
gaelagaqrpapsprqhhssqrvlvvrtrelpspsptrrrvlslvssgrrrpgappwpfqipele--eqld--t---qlt
          marappegrrpepvttplpdk rcfqlhllsprksrqrllel llqsmwytqaftlpwyeckpspergsg
                      i emla ag h a hgaeq qapec ihd   eaahttsecdsmilsvrgerkkdncv
                         g                       c    a   hdp   l agkhpaama  a  
                                                                   ae           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
kqpsgvssecdteggqlq----paerppqlrpggltslqtepqrhssyp----------------------------tps
pg-tddrl--n-ahrf-gdtshqqrqlrgsshhagagamdtrsdrlpa-tgmlhlfplthccgpglrptsqedkstq---
ral-----gs-lqdd-i-    drsnelstqtespqtplsmag----- msc                    eeeegmee
e- gepaw  eap  vf      klga  pa di lp dlf esqars l r                      a  vl 
a  a l a  a    r       ed    c     e  aea  qk ek                                
                                           k  dc                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                             ..                  . ::* :.*.:    
pps----------asmrqs-----------------------qaappd----l------rpeiwiarelRrigDefnasy
---qafnhylsampfrgrqrlfygnagyrlplpasfpaglpltseaangqwqvrgeeeqwaavrygqqf cms qlvdr-
escpsqgvm pcgvtqltp                       rqq  e    h      -- qec a   a k hrqf
a e          sleepl                       eg   g              rq          d  fl 
              aa g                         e                                    
                                                                                

       330       340       350       360       370   
....:....|....:....|....:....|....:....|....:....|...
                            .                        
pr---lnhyqaaedqpqmvilrllryivrlvwrmh------------------
--rvf--rpks-gtatklw-ssnwtraiqswynrnlgrlpvprggsapsqepn
kg   rp---qr-------q--------nvlsdvtmnleglgprhg  em   
e     rqme-qrqrqsr wwqvmnllsk glllie                 
        e   qhn np  qk  lf h  f  ge                  
                                                     
© 1998-2023Legal notice