Dataset for protein classical BH3-containing proteins of organism Chinchilla lanigera

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A8C2UGS8_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Chinchilla lanigera GN=BBC3 (length=194 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPTTTPALLPAAYLCAPTAPPALTAALGGPRWPG
GPRSRPRGPRPDGPQPPLSAAEQHLESPVPSAPEALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEE
QQRHRPSPWRVLYNLIMGLLPLPRGHGAPEMEPN
>gnl|bcl2dbpro|A0A8C2UYE1_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Chinchilla lanigera GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDTEGGQLQPAERPPQLRPGALTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAE
PPDLRPEIWIAQELRRIGDEFNASYPRRVFLNHYQAAEDQPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A8C2UYE1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Chinchilla lanigera GN=BCL2L11 (length=110 residues).
MAKQPSDVSSECDTEGGQLQPAERPPQLRPGALTSLQTEPQASMRQSQAEPPDLRPEIWIAQELRRIGDEFNASYPRRVF
LNHYQAAEDQPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A8C2UYE1_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Chinchilla lanigera GN=BCL2L11 (length=298 residues).
TRPGRRRSRQGTRRGQPRLYLSQPARAGSPRGAGAGLALPRAEAGLGGGGARGDWTRARSRQSELGCRAAQVSLRSAQPL
GAELAGAQRPAPSPPPHHRRQRILTVPLRALPHCSQHRLRQLQLPRSRRHRLGALPWPWYPQCLTLILELRSARKKDQMA
KQPSDVSSECDTEGGQLQPAERPPQLRPGALTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPP
DLRPEIWIAQELRRIGDEFNASYPRRVFLNHYQAAEDQPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A8C2VBL6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Chinchilla lanigera GN=BMF (length=259 residues).
MPRAGVFWKQYRAVCPGLLRARPPRRPPPAALGFPLLPHRVWAPSPRVLVTLDPGAEPWHHDSEADSLSWSHPGEMEPPQ
CVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSPSSPSQGVMLP
CGVTEEPQRLFYGNAGYRLPLPASFPAGLPLEEQPPEGQWQHRAEVQIARKLRCIADQFHRLHMQQRQQNQNRVWWQVLL
FLHNLGLNGEENREGVGPR
>gnl|bcl2dbpro|A0A8C2VWH6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Chinchilla lanigera GN=PMAIP1 (length=105 residues).
MPGKVCKSTPPPNSTRAPAELAAECAAQHRRIGDKLNALGCATEILETLAEMPGKKARKSAQLTLTGAPAELEVECAAQF
RRIGDKLNFRQKLMNLISKLFSLVT
>gnl|bcl2dbpro|A0A8C2W470_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Chinchilla lanigera GN=BAD (length=194 residues).
MRTPEKPSPAPTHAESLRKSEQGIRRLGAAQSMFQIPEFEPSEQEDSSSEERGLGPGPTGDRLGSNTAGGFLGDTSHQQR
QLRSSSHHGGAGAMDTRSRHSSYPTGMEEEEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKS
AGTATKLWQSSNWTRAIQSWWDRNLGRGGSAPSQ
>gnl|bcl2dbpro|A0A8C2W470_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Chinchilla lanigera GN=BAD (length=162 residues).
MFQIPEFEPSEQEDSSSEERGLGPGPTGDRLGSNTAGGFLGDTSHQQRQLRSSSHHGGAGAMDTRSRHSSYPTGMEEEEG
MEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATKLWQSSNWTRAIQSWWDRNLGRGGSAP
SQ
© 1998-2022Legal notice